DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9806 and APM1

DIOPT Version :10

Sequence 1:NP_572643.1 Gene:CG9806 / 31994 FlyBaseID:FBgn0030222 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_195035.2 Gene:APM1 / 829446 AraportID:AT4G33090 Length:879 Species:Arabidopsis thaliana


Alignment Length:237 Identity:41/237 - (17%)
Similarity:79/237 - (33%) Gaps:79/237 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PPPEPSFPTLIDSVDVPRVNQQSSNTYRSETPLQLLSQDTRRDLSCPSELTTITDFLT------- 157
            |.|.|:..:.:..:.:|          :.:..||.::.|.:...:|.|:...:.|..:       
plant   283 PSPYPNNASCVWLIRIP----------QGQVTLQFVAFDVQPSANCTSDYVRVFDGASKSSPVLL 337

  Fly   158 ---CIR-RLSTVTLDEHNMLCDFEKD---SGCRFKSISSPLSVGNFPNADHYRTFATLAGRPEEE 215
               |.| :|..:......||.:|..|   :...||:..:.:..|..    .|::...::.....:
plant   338 KRACGRAQLPVLISSARRMLVEFVSDAKHTAFGFKATFTTVQCGGV----FYKSPGNISSPGYPQ 398

  Fly   216 RPSGNFVFFIEHRGTDAEDEFIMSTPITCQKGNGVLRFNYWIVGQQDKVMLRVCTQN-HLSRSCT 279
            :.|.|.           :..:::|.|                  ...||.||:.|.| ..|..| 
plant   399 KYSANM-----------DCMYLISAP------------------YHQKVQLRIHTLNMEASTGC- 433

  Fly   280 QSIAYTPSTSSIAIEVVHPNSTFFEL-----------EIVAS 310
                     .|..:.|.:.|:|:..|           ||::|
plant   434 ---------KSDYLAVYNGNTTYSPLMHKFCGSLAPGEIISS 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9806NP_572643.1 M1_APN-Q_like 30..474 CDD:341064 41/237 (17%)
ERAP1_C 560..878 CDD:463368
APM1NP_195035.2 M1_APN-Q_like 18..453 CDD:341064 38/222 (17%)
ERAP1_C 536..855 CDD:463368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.