DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9806 and CG10602

DIOPT Version :9

Sequence 1:NP_572643.1 Gene:CG9806 / 31994 FlyBaseID:FBgn0030222 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_609916.5 Gene:CG10602 / 35146 FlyBaseID:FBgn0032721 Length:684 Species:Drosophila melanogaster


Alignment Length:563 Identity:119/563 - (21%)
Similarity:188/563 - (33%) Gaps:164/563 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TASNLRPLHY----NLSLLTEVEPLKLS--------------------GNFSGEVIIRLRVWR-- 61
            |:..|.|::.    |:..|..|:|...|                    ....|.|:.|.:|..  
  Fly    57 TSHKLLPIYQVQKRNMGRLGVVDPSSYSQPDLITTEHSALNWKIDFAATKIQGSVLHRFKVLTAN 121

  Fly    62 ------ETRTIILSNNGLQVGENVL--------------------LVRRNTGGRVTVRKMWQASS 100
                  :.|.|.::|..|..|.:.|                    |......|.:.||..::.||
  Fly   122 LDKILLDVRDINVTNATLLAGGSELPINFFISDAVDDIGQKLTLELPSGTAKGSLNVRIDYETSS 186

  Fly   101 VHQLGIVFNSMLWLGEEYTLVVQFSGQLSRASGYFVGGYMDSKHHPQWIAVTQLAPNLANTVFPC 165
                  ..:.:.||....||                     .|.||...:..|...  |.:|.||
  Fly   187 ------SASGLQWLNPTQTL---------------------GKEHPYMFSQCQAIH--ARSVIPC 222

  Fly   166 FENRTFLAPFILNLAHPRGTNAVSNMRVLKTSDHEKDDYVWTTFQQTPAMSVQKLAFSINRFTNR 230
            .:.......:...:.||      |.:..|.::..:|.:...|.|:|...:....:|.:|.:..:|
  Fly   223 QDTPAVKFTYDATVEHP------SELTALMSALIDKKEPGKTLFKQEVPIPAYLVAIAIGKLVSR 281

  Fly   231 TSAEIPKGPALTTWLRPKIADQGDYAISITPQIIVFFISLFGKPYPAMKIDQLVLPDTAYQSHEH 295
                 |.|...:.|....|.|......|.|..::.....|.| ||...:.|.||:|.        
  Fly   282 -----PLGENSSVWAEEAIVDACAEEFSETATMLKTATELCG-PYVWKQYDLLVMPP-------- 332

  Fly   296 LGLVSYP----EAAFLYSAQRSTTRAKQQVASHVAQEFAHHWLSDL---ENAALYWLHNGLSDYV 353
                |:|    |...|.....:.....:.:|..||.|.||.|..:|   :|...:||:.|.:.:|
  Fly   333 ----SFPFGGMENPCLTFVTPTLLAGDKSLADVVAHEIAHSWTGNLVTNKNFEHFWLNEGFTVFV 393

  Fly   354 SGFAVDNVEPAWR--FHELS-------MVRQALAVLVEDSK-----SSAYP----MSLAYASKSS 400
            ....|..::.|..  |..||       .:|..|....|.:|     |:..|    .|:.|.    
  Fly   394 ESKIVGRMQGAKELDFKMLSNLTDLQECIRTQLNKTPELTKLVVDLSNCGPDDAFSSVPYI---- 454

  Fly   401 DTQANQKSALLFRMLHSLI-GTQAFLNALRLYLQRSHKGSSSNQAFLWHTLQEESDNQMSL---- 460
                  |.:...|.|..|. |...|...||.||::          :.:.:: |..|.|.:|    
  Fly   455 ------KGSTFLRYLEDLFGGPTVFEPFLRDYLKK----------YAYKSI-ETKDFQSALYDYF 502

  Fly   461 ----RQDIKVSQL-MDSWTMQPGYPLIRVVRNYDTNEVTVTQE 498
                ::| |:|.: .|.|....|.|  .|:.|:|.:...||:|
  Fly   503 IDTDKKD-KLSAVDWDLWLKSEGMP--PVIPNFDESLANVTKE 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9806NP_572643.1 ERAP1_C 561..878 CDD:288671
Peptidase_M1 25..392 CDD:279741 89/443 (20%)
GluZincin 30..480 CDD:301352 109/536 (20%)
CG10602NP_609916.5 Ribosomal_L13 16..>50 CDD:294238
leuko_A4_hydro 79..681 CDD:274120 113/541 (21%)
M1_LTA4H 79..520 CDD:189006 104/515 (20%)
Leuk-A4-hydro_C 541..680 CDD:286244 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.