DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9806 and Aopep

DIOPT Version :9

Sequence 1:NP_572643.1 Gene:CG9806 / 31994 FlyBaseID:FBgn0030222 Length:911 Species:Drosophila melanogaster
Sequence 2:XP_008769651.1 Gene:Aopep / 290963 RGDID:1309592 Length:886 Species:Rattus norvegicus


Alignment Length:600 Identity:124/600 - (20%)
Similarity:199/600 - (33%) Gaps:186/600 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 TQLAPNLANTVFPCFENRTFLAPFILNLAHPRGTNAVSNMRVLKTSDHE------KDDYVWTTFQ 210
            |..:|.....:|||.|      |.:..........|.::..||.:.:..      ::.|:...:.
  Rat   335 TMGSPINNRALFPCQE------PPVAMSTWQATVRAAASFVVLMSGEKSAKPTPLREGYMSWHYY 393

  Fly   211 QTPAMSVQKLAFSINRFTNRTSAEIPKGPAL------TTWLRPKIAD--------QGDY------ 255
            .|..|.......::..:|...    ||...|      |..|||..||        ..:|      
  Rat   394 VTMPMPASTFTIAVGCWTEMK----PKTSPLDDLTEHTLPLRPSDADFRYGNTCSHMEYPCRFQS 454

  Fly   256 AISITPQIIVFFI--------------------------SLFGKPYPAMKIDQLVLPDTAYQSHE 294
            |.:.|..||.:.:                          |:.| .:|..::|.|::| |.:.|  
  Rat   455 ASAATQNIIPYRVFAPVCLEGACREALLWLIPSCLSAAHSVLG-THPFSRLDILIVP-TNFPS-- 515

  Fly   295 HLGLVSYPEAAFLYSAQRSTTRAKQQVASHVAQEFAHHWLSDLENAALYWLHNGLSDYVSGFAVD 359
             ||:.| |...||  :|.:.|.......:.:..|.||.|.. |...|..|....||:   |||..
  Rat   516 -LGMAS-PHIIFL--SQSTLTGTSHLCGTRLCHEIAHAWFG-LAIGARDWTEEWLSE---GFATH 572

  Fly   360 NVEPAW---------------------RFH----ELSMVRQALAVLVEDSKSSAYPMSLAYASKS 399
            ..:..|                     |:|    ||....:.:.||..:.:.:.: :|.:.||..
  Rat   573 LEDIFWAEAQQLPPHEALEQQELRACLRWHRLQDELQNSPEGMQVLRPNKEKTGH-VSASGASVV 636

  Fly   400 SDTQANQKSAL---------LFRMLHSLIGTQAFLNALRLYLQRSHKGSSSNQAFLWHTLQEESD 455
            .:....:|..:         |.|.|...:|.:.:...||.::...|.....:|.||...|:...:
  Rat   637 KNGLNPEKGFMQVHYLKGYFLLRFLARTLGEETYFPFLRKFVHLFHGQLILSQDFLQMLLESIPE 701

  Fly   456 NQMSLRQDIKVSQLMDSWTMQPGYP----------------LIRVVRNYDTNEVTVTQERFLRNP 504
            |:   |..:.|..::..|...||.|                |:|.|.:.....:.|.     |.|
  Rat   702 NK---RFGLSVENIVGDWLECPGIPKALQEERKAKDCSPSRLVRQVGSEVAKWIRVN-----RRP 758

  Fly   505 GKLMQKRQQCWWVPLTFATAGIDSFVSTLPSEWLTCQGRQTASPLILNEVAQP-----------D 558
            ||..:::::.     .|.....|..|..|  |||..|  :|.||..|:.:.|.           .
  Rat   759 GKRQRRKREA-----AFEKLSPDQIVLLL--EWLLEQ--KTLSPQTLHRLQQTYHLQEQDAEVRH 814

  Fly   559 KWVVFNLRLATPCRI--------TYDE-----RNWQLIGNALSGTNASSIDRFTRAQ-------- 602
            :|          |.:        .||:     :..|.:|..|.|....|.|  .|.|        
  Rat   815 RW----------CELVIKHKYTKAYDQVKRFLQEDQAMGIYLYGELMVSED--ARLQQLAHRCFE 867

  Fly   603 LISDVLNLAGAGVVT 617
            |:...::.|.|.|||
  Rat   868 LVKGHMDKASAQVVT 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9806NP_572643.1 ERAP1_C 561..878 CDD:288671 16/77 (21%)
Peptidase_M1 25..392 CDD:279741 63/316 (20%)
GluZincin 30..480 CDD:301352 84/413 (20%)
AopepXP_008769651.1 GluZincin 250..697 CDD:301352 77/384 (20%)
Leuk-A4-hydro_C 743..884 CDD:286244 36/165 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349308
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.