DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9806 and F49B2.6

DIOPT Version :10

Sequence 1:NP_572643.1 Gene:CG9806 / 31994 FlyBaseID:FBgn0030222 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_493503.2 Gene:F49B2.6 / 173297 WormBaseID:WBGene00009865 Length:1082 Species:Caenorhabditis elegans


Alignment Length:166 Identity:29/166 - (17%)
Similarity:47/166 - (28%) Gaps:80/166 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 RDLSCPSELTTITDFLTC--IRRLSTVTLDE---------HNMLCDFEKDSGCRFKSISSPLSVG 194
            :|||||          .|  ..:.|...:|.         ::::|       |.|..:.|     
 Worm    59 QDLSCP----------VCPLASKPSHKQMDVMAFSLSYMIYDLIC-------CHFDQVFS----- 101

  Fly   195 NFPNADHYRTFATLAGRPEEERPSGNFVFFIEHRGTDAEDEFIMSTPITCQKGNGVLRFNYWI-- 257
             ..||.|:  |.::.|                         ||..  :..||....:....|:  
 Worm   102 -IDNAVHH--FVSILG-------------------------FIAG--LAYQKSGSEIVATLWVAE 136

  Fly   258 --------------VGQQD-KVMLRVCTQNHLSRSC 278
                          :|.:| |:.|......|:|..|
 Worm   137 ISSPFFHLREILKEIGYKDTKLNLAADVSIHISSFC 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9806NP_572643.1 M1_APN-Q_like 30..474 CDD:341064 29/166 (17%)
ERAP1_C 560..878 CDD:463368
F49B2.6NP_493503.2 M1_APN-Q_like 209..649 CDD:341064
ERAP1_C 725..1024 CDD:463368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.