DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9806 and Rnpepl1

DIOPT Version :9

Sequence 1:NP_572643.1 Gene:CG9806 / 31994 FlyBaseID:FBgn0030222 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_852070.3 Gene:Rnpepl1 / 108657 MGIID:1914170 Length:720 Species:Mus musculus


Alignment Length:418 Identity:94/418 - (22%)
Similarity:146/418 - (34%) Gaps:98/418 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 FPCFENRTFLAPFILNLAHPRGTNAVSNMRVLKTSD-----HEKDDYVWTTFQQTPAMSVQKLAF 222
            ||||:.......:...:..|.|      ::||.::.     .|:..|.:......||..|..:|.
Mouse   201 FPCFDTPAVKCTYSAVVKAPLG------VQVLMSATQSVYVEEEGLYHFHMEHPVPAYLVALVAG 259

  Fly   223 SINRFTNRTSAEIPKGPALTTWLRPKIADQGDYAIS-ITPQIIVFFISLFGKPYPAMKIDQLVLP 286
            .:.      .|:|  ||....|..|.:.......:| ...|.:.....|:| ||...:.|.:.||
Mouse   260 DLK------PADI--GPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYG-PYMWGRYDIVFLP 315

  Fly   287 DTAYQSHEHLGLVSYPEAA-------FLYSAQRSTTRAKQQVASHVAQEFAHHWLSDLENAALY- 343
            .            |:|..|       |:.|   |...:.:.:...|..|.||.|..:....|.: 
Mouse   316 P------------SFPIVAMENPCLTFIIS---SILESDEFLVIDVIHEVAHSWFGNAVTNATWE 365

  Fly   344 --WLHNGLSDYVS--------GFAVDNVEPAWRFHELSMVRQALAVLVEDSKSSAYPMSLAYASK 398
              ||..||:.|..        |.|...:|.|:|   |..:.:.:.:|.|||..|...:.|.....
Mouse   366 EMWLSEGLATYAQRRITTETYGAAFTCLETAFR---LDALHRQMRLLGEDSPVSKLQVKLEPGVN 427

  Fly   399 SSDTQ---ANQKSALLFRMLHSLI-GTQAFLNALRLYLQRSHKGSSSNQAFLWHTLQEESDNQMS 459
            .|...   ..:|.......|..|. |.|.|.:.||.|::: :|.:|.       ..|:..|:.:|
Mouse   428 PSHLMNLFTYEKGYCFVYYLSQLCGGPQRFDDFLRAYVEK-YKFTSV-------VAQDLLDSFLS 484

  Fly   460 LRQDIKVSQL-------MDSWTMQPGYPLIRVVRNYDTNEVTVTQERFLRNPGKLMQKRQQCWWV 517
            ...::|...:       .:.|....|.||.         |..::|...|..|   ::...|.|..
Mouse   485 FFPELKEQSVDCRAGLEFERWLNATGPPLA---------EPDLSQGSSLTRP---VEALFQLWTA 537

  Fly   518 -PLTFATA---GIDSFVSTLPSEWLTCQ 541
             ||..|.|   .||.      |:|.|.|
Mouse   538 EPLEQAAASASAIDI------SKWRTFQ 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9806NP_572643.1 ERAP1_C 561..878 CDD:288671
Peptidase_M1 25..392 CDD:279741 57/252 (23%)
GluZincin 30..480 CDD:301352 76/351 (22%)
Rnpepl1NP_852070.3 M1_LTA4H 29..507 CDD:189006 75/346 (22%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P15144 321..325 1/3 (33%)
Leuk-A4-hydro_C 524..668 CDD:312599 14/45 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.