DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and YPT1

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_116615.1 Gene:YPT1 / 850505 SGDID:S000001856 Length:206 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:68/169 - (40%)
Similarity:104/169 - (61%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQYDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTS 66
            |:||..||::::|:|||||:|||:||||:.:|..:..|:|:|.:..:||. |.:..: ||:|||:
Yeast     3 SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVK-LQIWDTA 65

  Fly    67 DDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQ 131
            ..|||:.:.::..|.:|||::|||:|..:||..:..|::||.|.....|..||||||.|..:.|.
Yeast    66 GQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRV 130

  Fly   132 VSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170
            |.......:|....:.|.|.||....||.|.|.::|..|
Yeast   131 VEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 65/163 (40%)
Rab 8..167 CDD:206640 63/158 (40%)
YPT1NP_116615.1 Rab1_Ypt1 7..172 CDD:206661 65/165 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.