DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and RA-5

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_171715.1 Gene:RA-5 / 837023 AraportID:AT1G02130 Length:203 Species:Arabidopsis thaliana


Alignment Length:170 Identity:71/170 - (41%)
Similarity:105/170 - (61%) Gaps:6/170 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGR--MLQVWDT 65
            :||..||::::|||||||:|||:||||:.:.|.:..|:|:|.:..:||    :.|:  .||:|||
plant     4 EYDYLFKLLLIGDSGVGKSCLLLRFSDDSYVESYISTIGVDFKIRTVE----QDGKTIKLQIWDT 64

  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHR 130
            :..|||:.:.::..|.||||::|||:|..:||.|:..|:.||.|...|.|..||||||||...:|
plant    65 AGQERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKSDLTENR 129

  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170
            .:.......:|....|.|.|.|||...||...|.:::..|
plant   130 AIPYETAKAFADEIGIPFMETSAKDATNVEQAFMAMSASI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 69/165 (42%)
Rab 8..167 CDD:206640 68/160 (43%)
RA-5NP_171715.1 Rab1_Ypt1 7..172 CDD:206661 69/167 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.