DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and ATFP8

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_187779.1 Gene:ATFP8 / 820345 AraportID:AT3G11730 Length:205 Species:Arabidopsis thaliana


Alignment Length:171 Identity:67/171 - (39%)
Similarity:105/171 - (61%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQYDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGR--MLQVWD 64
            ::||..||::::|||.|||:|||:||:|:.:.:.:..|:|:|.:..::|    :.|:  .||:||
plant     3 NEYDYLFKLLLIGDSSVGKSCLLLRFADDAYIDSYISTIGVDFKIRTIE----QDGKTIKLQIWD 63

  Fly    65 TSDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNH 129
            |:..|||:.:.::..|.||||::|||.|..:||.|:..|:.||.|...:.|..||:|||:|....
plant    64 TAGQERFRTITSSYYRGAHGIIIVYDCTEMESFNNVKQWLSEIDRYANESVCKLLIGNKNDMVES 128

  Fly   130 RQVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170
            :.||...|...|....|.|.|.|||...||...|.::|.:|
plant   129 KVVSTETGRALADELGIPFLETSAKDSINVEQAFLTIAGEI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 65/165 (39%)
Rab 8..167 CDD:206640 63/160 (39%)
ATFP8NP_187779.1 Rab1_Ypt1 7..172 CDD:206661 65/167 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.