DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and RABE1e

DIOPT Version :10

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_187601.1 Gene:RABE1e / 820148 AraportID:AT3G09900 Length:218 Species:Arabidopsis thaliana


Alignment Length:83 Identity:22/83 - (26%)
Similarity:36/83 - (43%) Gaps:23/83 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PFDPKRHAREQHNALERRRRDNIKDMYTSLREVVPDANGE-RVQASRAVILKKAIESIEKGQSDS 86
            |.|||:..          .|::..|....:|:...|.:|| :||..        ||:.|    ||
plant  1011 PVDPKQVG----------IRNSEADTILFIRKAERDHSGEYKVQIQ--------IENCE----DS 1053

  Fly    87 ATLSVDVAEQESKNAKLR 104
            ||:.:.:.::.|...||:
plant  1054 ATICIQIVDKPSAPQKLK 1071

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 Rab 8..167 CDD:206640 22/83 (27%)
RABE1eNP_187601.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.