DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and rab33a

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001038893.1 Gene:rab33a / 751718 ZFINID:ZDB-GENE-060825-283 Length:236 Species:Danio rerio


Alignment Length:198 Identity:70/198 - (35%)
Similarity:98/198 - (49%) Gaps:21/198 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTSDDERF- 71
            ||||::|||.||||||..||:...|..:...|:|:|.||.:||....::  .:|||||:..||| 
Zfish    39 FKIIVIGDSNVGKTCLTFRFTGGAFPCKTEATIGVDFREKAVEIEGEKI--KVQVWDTAGQERFR 101

  Fly    72 KLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLC-----PDKVTVLLVGNKSDDPNHRQ 131
            |.:.....|:.|.::.|||:|...||||:..|::|    |     ...|..:|||||.|..:..|
Zfish   102 KSMVEHYYRNVHAVVFVYDVTKMASFQNLKTWIQE----CNGHGVSSAVPRVLVGNKCDLVDQIQ 162

  Fly   132 VSMAQGFNYAHRQSICFEEVSA---KSGRNVYDIFSSLAMDIYTYRRVHYNPFSLTSWQEEEDAE 193
            |.......:|...::...|.||   |..:||..||..||..:...:.:.|...      |.||..
Zfish   163 VPSNTALKFADAYNMLLFETSAKDPKESQNVDSIFMCLACRLKAQKSLIYRDV------EREDGR 221

  Fly   194 ESL 196
            ..|
Zfish   222 VRL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 65/171 (38%)
Rab 8..167 CDD:206640 63/167 (38%)
rab33aNP_001038893.1 Rab33B_Rab33A 37..206 CDD:133315 65/172 (38%)
RAB 39..207 CDD:197555 65/173 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.