DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and rab33ba

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001028764.1 Gene:rab33ba / 572060 ZFINID:ZDB-GENE-050809-122 Length:239 Species:Danio rerio


Alignment Length:215 Identity:69/215 - (32%)
Similarity:106/215 - (49%) Gaps:44/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTSDDERF- 71
            ||||::||||||||||..||...:|.::...|:|:|.||..:|....::  .:|:|||:..||| 
Zfish    27 FKIIVIGDSGVGKTCLTYRFCAGKFPDKTEATIGVDFREKVIEIDGEKI--KVQLWDTAGQERFR 89

  Fly    72 KLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRR-LCPDKVTVLLVGNKSDDPNHRQVSMA 135
            |.:.....|:.|.::.|||:|::.||:::..|::|.|: ....:|..:|||||.|..:..|||..
Zfish    90 KSMVQHYYRNVHAVVFVYDVTNAASFRSLPAWIEECRQHALGQEVPRILVGNKCDLRHAAQVSTD 154

  Fly   136 QGFNYAHRQSICFEEVSAK-----------SGRNVYDIFSSLAM------------------DIY 171
            ....:|...|:...|.|||           :..:|..||.::|.                  |..
Zfish   155 VAQQFADTHSMPLFETSAKNPYGNEDGTQNNSDHVEAIFMTVAHKLKSQKPLVLSQPPCGYGDTV 219

  Fly   172 TYRRVHYNPFSLTSWQEEED 191
            |.||           |::||
Zfish   220 TLRR-----------QDQED 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 63/193 (33%)
Rab 8..167 CDD:206640 61/171 (36%)
rab33baNP_001028764.1 Rab33B_Rab33A 25..202 CDD:133315 62/176 (35%)
RAB 27..203 CDD:197555 62/177 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.