DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and rab19

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001017246.1 Gene:rab19 / 550000 XenbaseID:XB-GENE-495128 Length:213 Species:Xenopus tropicalis


Alignment Length:189 Identity:63/189 - (33%)
Similarity:101/189 - (53%) Gaps:9/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTSDD 68
            :|..||||::|||.|||||::.||....|....:.|:|:|....::.....::  .:|||||:..
 Frog    12 FDFLFKIILIGDSNVGKTCVVHRFQSGVFAHNQQNTIGVDFTVRNMNINGKKV--KVQVWDTAGQ 74

  Fly    69 ERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQVS 133
            |||:.:..:..|||||.::.||||..:||:::..|:.|..:.....:.::|:|||||....||:.
 Frog    75 ERFRTITQSYYRSAHGAIIAYDITRRQSFESVPHWIYEAEKYGAANLMMMLIGNKSDLAEKRQIL 139

  Fly   134 MAQGFNYAHRQS-ICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHY------NPFSLTS 185
            ..:....|.:.. :...|.|||...||.::|..:|.::......||      |.|.|.|
 Frog   140 FEEACTLAEKHGLLAVLETSAKESHNVDEVFLLMAKELIARNTFHYHSESPRNSFMLDS 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 56/163 (34%)
Rab 8..167 CDD:206640 55/159 (35%)
rab19NP_001017246.1 Rab19 13..177 CDD:133267 57/165 (35%)
Effector region. /evidence=ECO:0000250 44..52 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.