DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and rab33b

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001008109.1 Gene:rab33b / 493471 XenbaseID:XB-GENE-491301 Length:226 Species:Xenopus tropicalis


Alignment Length:171 Identity:67/171 - (39%)
Similarity:100/171 - (58%) Gaps:7/171 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTSDDERF- 71
            ||||::|||.||||||..||....|.||...|:|:|.||.:|:....|:  .:|:|||:..||| 
 Frog    33 FKIIVIGDSNVGKTCLTYRFCTCCFPERTEATIGVDFRERTVDIDGERI--KIQLWDTAGQERFR 95

  Fly    72 KLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRR-LCPDKVTVLLVGNKSDDPNHRQV--S 133
            |.:.....|:.|.::.|||||:..|||::..|::|.:: |..:.|..:|||||.|.....||  .
 Frog    96 KSMVQHYYRNVHAVVFVYDITNMASFQSLPAWIEECKQHLISNDVPRILVGNKCDLRGSIQVPTD 160

  Fly   134 MAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYR 174
            |||.|..:|...: ||..:..:..:|..||.:||..:.:::
 Frog   161 MAQKFADSHSMPM-FETSAKNTNDHVEAIFMTLAHKLKSHK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 67/166 (40%)
Rab 8..167 CDD:206640 65/162 (40%)
rab33bNP_001008109.1 Rab33B_Rab33A 31..198 CDD:133315 67/167 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.