DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and RAB19

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001008749.2 Gene:RAB19 / 401409 HGNCID:19982 Length:217 Species:Homo sapiens


Alignment Length:175 Identity:59/175 - (33%)
Similarity:97/175 - (55%) Gaps:3/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTSDD 68
            :|..||||::|||.|||||::..|....:||..:.|:|:|....|::. |.:..:| |||||:..
Human    14 FDYLFKIILIGDSNVGKTCVVQHFKSGVYTETQQNTIGVDFTVRSLDI-DGKKVKM-QVWDTAGQ 76

  Fly    69 ERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQVS 133
            |||:.:..:..||||..::.||:|...:|::|..|:.||.:.....|.::|:|||.|....|.|.
Human    77 ERFRTITQSYYRSAHAAIIAYDLTRRSTFESIPHWIHEIEKYGAANVVIMLIGNKCDLWEKRHVL 141

  Fly   134 MAQGFNYAHRQS-ICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVH 177
            .......|.:.. :...|.|||..:|:.::|..:|.::.....:|
Human   142 FEDACTLAEKYGLLAVLETSAKESKNIEEVFVLMAKELIARNSLH 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 57/163 (35%)
Rab 8..167 CDD:206640 56/159 (35%)
RAB19NP_001008749.2 Rab19 15..179 CDD:133267 58/165 (35%)
Effector region. /evidence=ECO:0000250 46..54 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.