DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and rab13

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_958486.1 Gene:rab13 / 373105 ZFINID:ZDB-GENE-030826-30 Length:200 Species:Danio rerio


Alignment Length:195 Identity:79/195 - (40%)
Similarity:114/195 - (58%) Gaps:6/195 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTSD 67
            :||..||::::||||||||||::||:::.|...:..|:|:|.:..::|....::  .||||||:.
Zfish     4 KYDFLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKV--KLQVWDTAG 66

  Fly    68 DERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQV 132
            .||||.:.....|.|.||:||||||..||::||..|||.|:......|:.:|:|||.|....|:|
Zfish    67 QERFKTITTAYYRGAMGIILVYDITDEKSYENIQNWMKSIKENASAGVSRMLLGNKCDIEAKRKV 131

  Fly   133 SMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNP----FSLTSWQEEEDAE 193
            |...|...|....|.|.|.||||..||.:.|:|||.||.........|    ..|||.:::..::
Zfish   132 SKETGEKLAKEHGIRFFETSAKSSINVEESFTSLARDILLKSNKKPGPSGREVKLTSTEKKSSSK 196

  Fly   194  193
            Zfish   197  196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 72/162 (44%)
Rab 8..167 CDD:206640 69/158 (44%)
rab13NP_958486.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 74/167 (44%)
RAB 9..170 CDD:197555 72/162 (44%)
Effector region. /evidence=ECO:0000250 37..45 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..195 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.