Sequence 1: | NP_572642.1 | Gene: | Rab9Db / 31993 | FlyBaseID: | FBgn0030221 | Length: | 197 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_958486.1 | Gene: | rab13 / 373105 | ZFINID: | ZDB-GENE-030826-30 | Length: | 200 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 79/195 - (40%) |
---|---|---|---|
Similarity: | 114/195 - (58%) | Gaps: | 6/195 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 QYDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTSD 67
Fly 68 DERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQV 132
Fly 133 SMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNP----FSLTSWQEEEDAE 193
Fly 194 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab9Db | NP_572642.1 | RAB | 8..171 | CDD:197555 | 72/162 (44%) |
Rab | 8..167 | CDD:206640 | 69/158 (44%) | ||
rab13 | NP_958486.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 74/167 (44%) |
RAB | 9..170 | CDD:197555 | 72/162 (44%) | ||
Effector region. /evidence=ECO:0000250 | 37..45 | 2/7 (29%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 173..195 | 4/21 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |