DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and Rabl6

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001102043.1 Gene:Rabl6 / 362084 RGDID:1307615 Length:731 Species:Rattus norvegicus


Alignment Length:257 Identity:57/257 - (22%)
Similarity:91/257 - (35%) Gaps:90/257 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGR-----MLQV 62
            ||:  .||:|.||...|||.|..|....:|.|.:..|     :|..|....|....     .::|
  Rat    41 QYN--MKIVIRGDRNTGKTALWHRLQGKKFVEEYIPT-----QEIQVTSIHWNYKTTDDVVKVEV 98

  Fly    63 WDTSDDERFKLLKATQC------------------------RSAHGILLVYDITSSKSFQNIDGW 103
            ||..|..:.|  |...|                        ::.:|:::::|||...:|..:   
  Rat    99 WDVVDKGKCK--KRGDCLKTENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYV--- 158

  Fly   104 MKEIRRLCPDKVTVLLVGNKSDDPNHRQV--------------------------SMAQ--GFNY 140
            ::|:.:: |..|.|.::||..|...||.:                          ||..  |..|
  Rat   159 LRELPKV-PTHVPVCVLGNYRDMGEHRVILPDDVRDFIEHLDRPPGSSYFRYAESSMKNSFGLKY 222

  Fly   141 AHR-QSICF-----EEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNPFSLTSWQEEEDAEESL 196
            .|: .:|.|     |.:..:...|..||.::|.              .|:..||.||...|:
  Rat   223 LHKFFNIPFLQLQRETLLRQLETNQLDIDATLE--------------ELSVQQETEDQNYSI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 49/225 (22%)
Rab 8..167 CDD:206640 48/221 (22%)
Rabl6NP_001102043.1 P-loop_NTPase 44..221 CDD:304359 40/187 (21%)
Ras 45..221 CDD:278499 40/186 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.