DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and Rab3

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster


Alignment Length:167 Identity:63/167 - (37%)
Similarity:97/167 - (58%) Gaps:3/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTSDD 68
            :|..||::|:|:|.||||..|.|::|:.||.....|||:|.:..:|...|.|:  .||:|||:..
  Fly    18 FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRV--KLQIWDTAGQ 80

  Fly    69 ERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQVS 133
            ||::.:.....|.|.|.:|:||:|:..||.::..|:.:|:....|...|:|||||.|..:.|.:|
  Fly    81 ERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVIS 145

  Fly   134 MAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170
            ..:|...|.:..:.|.|.|||...||..:|..| :||
  Fly   146 FERGRQLADQLGVEFFETSAKENVNVKAVFERL-VDI 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 62/163 (38%)
Rab 8..167 CDD:206640 59/158 (37%)
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 62/164 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.