DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and Rab9Fb

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_727472.1 Gene:Rab9Fb / 32029 FlyBaseID:FBgn0052670 Length:214 Species:Drosophila melanogaster


Alignment Length:199 Identity:122/199 - (61%)
Similarity:148/199 - (74%) Gaps:7/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQYDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGR--MLQVW 63
            |||||..|||::|||.||||:|||||||||:|||:|..|||||.|..:||.|    ||  |||:|
  Fly     1 MSQYDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELA----GRMVMLQIW 61

  Fly    64 DTSDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPN 128
            ||:.|||||.|..:..|.||||||||||||||||:|||||:|||||:..:.|.|:|||||.||.:
  Fly    62 DTAGDERFKSLLPSYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

  Fly   129 HRQVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNPFSLTSWQEEEDAE 193
            :|||.|.||||||:.:::.|.|||||||.||.|:|:.|::.||. |.|.:.|..|:..||.||..
  Fly   127 NRQVRMEQGFNYANHRALGFYEVSAKSGANVNDVFNMLSVGIYN-RLVIHTPNRLSGGQETEDTA 190

  Fly   194 ESLD 197
            |..|
  Fly   191 EPPD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 105/164 (64%)
Rab 8..167 CDD:206640 104/160 (65%)
Rab9FbNP_727472.1 RAB 8..171 CDD:197555 107/167 (64%)
Rab 8..165 CDD:206640 104/160 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464163
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0009971
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.