DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and Rab9E

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster


Alignment Length:197 Identity:191/197 - (96%)
Similarity:192/197 - (97%) Gaps:0/197 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQYDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDT 65
            |||||||||||||||||||||||||||||||||.|||.|:|||||||||||||||||||||||||
  Fly     1 MSQYDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDT 65

  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHR 130
            ||||||||||||.|||||||||||||||||||||||||||||||||||||.||||||||||||||
  Fly    66 SDDERFKLLKATHCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHR 130

  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNPFSLTSWQEEEDAEES 195
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.||
  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNPFSLTSWQEEEDAAES 195

  Fly   196 LD 197
            ||
  Fly   196 LD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 157/162 (97%)
Rab 8..167 CDD:206640 153/158 (97%)
Rab9ENP_727438.1 RAB 8..171 CDD:197555 157/162 (97%)
Rab 8..167 CDD:206640 153/158 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464157
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29620
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009971
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.