DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and Rab33a

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001101727.1 Gene:Rab33a / 317580 RGDID:1563280 Length:237 Species:Rattus norvegicus


Alignment Length:185 Identity:68/185 - (36%)
Similarity:95/185 - (51%) Gaps:9/185 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQY--DNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVW 63
            |.||  ...||||::|||.||||||..||....|.::...|:|:|.||.:||....::  .:|||
  Rat    28 MDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKI--KVQVW 90

  Fly    64 DTSDDERF-KLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIR-RLCPDKVTVLLVGNKSDD 126
            ||:..||| |.:.....|:.|.::.|||:|...||.|:..|::|.. ...|..|..:|||||.|.
  Rat    91 DTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDL 155

  Fly   127 PNHRQVSMAQGFNYAHRQSICFEEVSA---KSGRNVYDIFSSLAMDIYTYRRVHY 178
            ....||.......:|...::...|.||   |..:||..||..||..:...:.:.|
  Rat   156 REQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 64/167 (38%)
Rab 8..167 CDD:206640 62/163 (38%)
Rab33aNP_001101727.1 Rab33B_Rab33A 35..204 CDD:133315 64/170 (38%)
RAB 37..205 CDD:197555 64/169 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.