DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and Rab15

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_942044.1 Gene:Rab15 / 299156 RGDID:735172 Length:212 Species:Rattus norvegicus


Alignment Length:200 Identity:71/200 - (35%)
Similarity:113/200 - (56%) Gaps:10/200 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTSD 67
            |||..|:::::|||||||||||.||:||:|...|..|:|:|.:..::|....::  .:|:|||:.
  Rat     4 QYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKV--RIQIWDTAG 66

  Fly    68 DERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQV 132
            .||::.:.....|.|.||.|||||:|.:|:|:|..|:.::....|:.|..:|:|||:|:...|||
  Rat    67 QERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQV 131

  Fly   133 SMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLA--------MDIYTYRRVHYNPFSLTSWQEE 189
            ...||...|....:.|.|.||.:..|:.:.|:.|.        .::...|....|..:|...:|:
  Rat   132 GREQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELDGLRTCASNELALAELEED 196

  Fly   190 EDAEE 194
            |...|
  Rat   197 EGKTE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 62/170 (36%)
Rab 8..167 CDD:206640 61/158 (39%)
Rab15NP_942044.1 Rab15 9..172 CDD:206698 62/164 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.