DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and RAB12

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001020471.3 Gene:RAB12 / 201475 HGNCID:31332 Length:340 Species:Homo sapiens


Alignment Length:167 Identity:68/167 - (40%)
Similarity:99/167 - (59%) Gaps:3/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTSDDE 69
            |...::||:|..|||||.|:.||:|:.|.|..:.|||:|.:..:||....::  .||:|||:..|
Human   136 DFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKI--RLQIWDTAGQE 198

  Fly    70 RFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQVSM 134
            ||..:.:...|||.||:||||||..::|.::..|||.|.:...:...:||||||.|....|:::.
Human   199 RFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITR 263

  Fly   135 AQGFNYAHR-QSICFEEVSAKSGRNVYDIFSSLAMDI 170
            .||..:|.: ..:.|.|.|||...||.:||..|..||
Human   264 QQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 67/164 (41%)
Rab 8..167 CDD:206640 64/159 (40%)
RAB12NP_001020471.3 Rab12 139..340 CDD:206699 67/164 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.