DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and rab-30

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_499328.1 Gene:rab-30 / 176476 WormBaseID:WBGene00004282 Length:216 Species:Caenorhabditis elegans


Alignment Length:183 Identity:63/183 - (34%)
Similarity:99/183 - (54%) Gaps:8/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQYDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDT 65
            |..|...||::::|::|||||||:.:|:...|......|:|:|....:|:..:.::  .||:|||
 Worm     1 MEDYKYLFKVVLVGNAGVGKTCLVRKFTQGIFPPGQSATIGVDFMIKTVKVGNDKI--KLQIWDT 63

  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHR 130
            :..|||:.:..:..||||.|:||||::...||..:..|:.||......:|..:|||||.|..:.|
 Worm    64 AGQERFRSITQSYYRSAHAIVLVYDVSCQPSFDCLPEWLGEIESYANRRVLKILVGNKVDKGDER 128

  Fly   131 QVSMAQGFNYAH-RQSICFEEVSAKSGRNVYDIFSSLAMDI-----YTYRRVH 177
            :|....|.:::. .|...|.|.||....||..:|..:|..:     .|..|||
 Worm   129 EVPERIGRDFSDVNQFDYFLETSALDATNVDQLFEQVATRLTNDMKLTDERVH 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 57/168 (34%)
Rab 8..167 CDD:206640 56/159 (35%)
rab-30NP_499328.1 P-loop_NTPase 1..170 CDD:304359 59/170 (35%)
RAB 8..169 CDD:197555 57/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.