DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9Db and rab-33

DIOPT Version :9

Sequence 1:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_499314.1 Gene:rab-33 / 176470 WormBaseID:WBGene00004283 Length:307 Species:Caenorhabditis elegans


Alignment Length:196 Identity:64/196 - (32%)
Similarity:103/196 - (52%) Gaps:19/196 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRE--CSVEFADWRMGRMLQVWDTSDDER 70
            ||:||:|::.||||||..||...:|.|....|:|:|.||  |.:|....|    :|:|||:..||
 Worm   101 FKVIIVGNAAVGKTCLSFRFCCGRFPEHTEATIGVDFRERSCVIENELLR----VQLWDTAGQER 161

  Fly    71 FK-LLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRR--LCPD-KVTVLLVGNKSDDPNHRQ 131
            :: .:.|...|:.:.::.|||:|..:||.::..|:||..:  |..| :|..:|:|||.|.....:
 Worm   162 YRQSIVAHYYRNVNAVVFVYDVTCRESFNDLALWIKECEKHGLVGDSEVPRILIGNKCDVECTNR 226

  Fly   132 VSMAQGFNYAHRQSICFEEVSAK---SGRNVYDIFSSLAMDIYTYRRVHYNPFSLTSWQEEEDAE 193
            ||..:...:|.|.::...|.|||   ...:|..||.:|...:...:.:|...      |:|...:
 Worm   227 VSTDEAQMFADRNNMALFETSAKLASEADHVESIFLTLLHKLQQSKPMHVQS------QDERHQK 285

  Fly   194 E 194
            |
 Worm   286 E 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 60/171 (35%)
Rab 8..167 CDD:206640 59/167 (35%)
rab-33NP_499314.1 Rab33B_Rab33A 99..270 CDD:133315 60/172 (35%)
RAB 101..270 CDD:197555 60/172 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.