Sequence 1: | NP_572642.1 | Gene: | Rab9Db / 31993 | FlyBaseID: | FBgn0030221 | Length: | 197 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_499314.1 | Gene: | rab-33 / 176470 | WormBaseID: | WBGene00004283 | Length: | 307 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 64/196 - (32%) |
---|---|---|---|
Similarity: | 103/196 - (52%) | Gaps: | 19/196 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 FKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRE--CSVEFADWRMGRMLQVWDTSDDER 70
Fly 71 FK-LLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRR--LCPD-KVTVLLVGNKSDDPNHRQ 131
Fly 132 VSMAQGFNYAHRQSICFEEVSAK---SGRNVYDIFSSLAMDIYTYRRVHYNPFSLTSWQEEEDAE 193
Fly 194 E 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab9Db | NP_572642.1 | RAB | 8..171 | CDD:197555 | 60/171 (35%) |
Rab | 8..167 | CDD:206640 | 59/167 (35%) | ||
rab-33 | NP_499314.1 | Rab33B_Rab33A | 99..270 | CDD:133315 | 60/172 (35%) |
RAB | 101..270 | CDD:197555 | 60/172 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0084 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |