DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43347 and Sry-beta

DIOPT Version :9

Sequence 1:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster
Sequence 2:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster


Alignment Length:480 Identity:86/480 - (17%)
Similarity:145/480 - (30%) Gaps:204/480 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   934 SCREC---SIAHDHKLCPLRNACGNVTDAVDLGEWIERRNLEALAKLKADAQRQAK--------- 986
            :||:|   ...:|..:..|......:.||: ||    .|.:|..|:.|..|.::|:         
  Fly    58 ACRDCLEYLFNYDRLVRNLSQVQRQIADAL-LG----CRQVEGKAETKQQAAKRARVQVPAFKIV 117

  Fly   987 -----RASGRQRHEDDDMEDMEDMDMDMDESSQLSELETKPLITFAEASVPAEFELHNVEPNVTG 1046
                 :...||..|:|:.|:....:| :||..|.||         .:.|:|:             
  Fly   118 QATALKEPERQPGEEDECEEFMKEEM-LDEEFQFSE---------PDDSMPS------------- 159

  Fly  1047 VFARTEVRAFTKLGPLIGQPVQTGEVREGSDMKWIFEMCEAGADKSYLLCCDNPNASNWLRFVRP 1111
                :|...||          :|.|:                                       
  Fly   160 ----SEEEFFT----------ETTEI--------------------------------------- 171

  Fly  1112 APSYEERNVNLVSIDRQAYFVSCRDLRNGMELLYWSDDCNTMWRKKHTEKTNCGGCNLKFEHPLY 1176
             |.:                 .|.::.:..|:|           ::|.:...|            
  Fly   172 -PCH-----------------ICGEMFSSQEVL-----------ERHIKADTC------------ 195

  Fly  1177 YRTHCSVFHDPSMSLTIRKYHCKVCGEPVLGKDNIMKHAAEKHDGKGAYQCQFCSKFFLR----L 1237
                     ..|...|     |.|||..| ..|.::......|:||...:|::|.|.|..    |
  Fly   196 ---------QKSEQAT-----CNVCGLKV-KDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVL 245

  Fly  1238 NYLEMHRTYGCASNPNRSRPVCDFCGRKFCQPQKLKAHIKRMHSDMAEVLRDFQCKLCSKLLGSR 1302
            .::|:|.        ::.:..||.||.:|.....:..|:.|                        
  Fly   246 RHMEVHW--------DKKKYQCDKCGERFSLSWLMYNHLMR------------------------ 278

  Fly  1303 AALQRHSKEVHSRNSTVVSCPRCQKLFQNRSNLKIHMLTHSGVRP-FKCAEPECNAAFTTKQCLQ 1366
                      |......:.|..|.:.|:.:...|.|:.||...|| :.|  |:|..:|..|..|:
  Fly   279 ----------HDAEENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPC--PDCEKSFVDKYTLK 331

  Fly  1367 FHYKKVHNYTQEQMPKIERSVAYTF 1391
            .| |:||...::......:....||
  Fly   332 VH-KRVHQPVEKPESAEAKEATVTF 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 21/73 (29%)
C2H2 Zn finger 1198..1219 CDD:275368 6/20 (30%)
C2H2 Zn finger 1227..1255 CDD:275368 7/31 (23%)
C2H2 Zn finger 1259..1280 CDD:275368 7/20 (35%)
C2H2 Zn finger 1292..1313 CDD:275368 0/20 (0%)
C2H2 Zn finger 1322..1342 CDD:275368 5/19 (26%)
zf-H2C2_2 1334..1361 CDD:290200 10/27 (37%)
C2H2 Zn finger 1350..1373 CDD:275368 8/22 (36%)
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 6/20 (30%)
C2H2 Zn finger 231..251 CDD:275368 6/19 (32%)
C2H2 Zn finger 259..308 CDD:275368 13/82 (16%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523 8/24 (33%)
C2H2 Zn finger 317..337 CDD:275368 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.