DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43347 and CG10654

DIOPT Version :9

Sequence 1:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:455 Identity:88/455 - (19%)
Similarity:154/455 - (33%) Gaps:130/455 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   935 CRECSIAHDHKLCPLRNACGNVTDAVDL--------GEWIERRNLEALAKLKA------------ 979
            ||.|.:     |...::||.|:....||        || ...|:|.....||:            
  Fly    40 CRACLV-----LLGPQDACHNLDSEQDLASKYYGCTGE-DAVRDLPPQLVLKSICECCYQLVQKF 98

  Fly   980 -DAQRQAKRASGRQRHEDDDMEDMEDMDM-----------DMDESSQLSELETKPLITFAEASVP 1032
             |.||..  |...:..|    :.::|:|:           |:|..|:.:| .|.|   .|::..|
  Fly    99 HDFQRMC--AESLRNFE----KLLQDIDIGCHKLEDHTWHDLDTPSESNE-STNP---EAQSHAP 153

  Fly  1033 AEFELHNVEPNVTGVFARTEVRAFTKLGPLIGQPVQTGEVREGSDMKWIFEMCEAGADKSYLLCC 1097
            .             :.|..|:.:|  :.|.:..|:..           |......||        
  Fly   154 C-------------IAATQEIVSF--IWPQVCLPLAV-----------ILSRITLGA-------- 184

  Fly  1098 DNPNASNWLRFVRPAPSYEERNVNLVSIDRQAYFVSCRDLRN--GMELLYWSDDCNTMWRKKHTE 1160
                                      |::.:.|.:.....:.  |.|.|..|.......:::...
  Fly   185 --------------------------SLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRGVR 223

  Fly  1161 KT-NCGGCNLKFEHPLYYRTHCSVFHDPSMSLTIRKYHCKVCGEPVLGKDNIMKHAAEKHDGKGA 1224
            .| .|..|:..|..|.....|... |:     .:|.|.|..|.:.....:.:..|..:.|:...|
  Fly   224 HTLECRICHRGFYKPSLLEAHMQQ-HE-----GLRPYTCVHCAKSYARANLLESHLRQMHNNADA 282

  Fly  1225 ----YQCQFCSKFF-----LRLNYLEMHRTYGCASNPNRSRPVCDFCGRKFCQPQKLKAHIKRMH 1280
                |.|..|:|.:     |:.:....|..|..:.:|: :|.:|:.||:.|.:...|..| |.:|
  Fly   283 ARIIYACPSCNKVYTANRSLKYHMRRTHERYHESESPD-ARHICEECGKCFARKAHLTRH-KMVH 345

  Fly  1281 SDMAEVLRDFQCKLCSKLLGSRAALQRHSKEVHSRNSTVVSCPRCQKLFQNRSNLKIHMLTHSGV 1345
            ..:..  |.:.|:.|.:...::..:..|....|...:.::.|.:|.::|||...|..|...|..:
  Fly   346 GSVEG--RRYCCECCDRRFYTKENMVDHLLRKHGNKNLLLRCRKCGRIFQNSVELNAHGRKHKAM 408

  Fly  1346  1345
              Fly   409  408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 18/78 (23%)
C2H2 Zn finger 1198..1219 CDD:275368 3/20 (15%)
C2H2 Zn finger 1227..1255 CDD:275368 7/32 (22%)
C2H2 Zn finger 1259..1280 CDD:275368 7/20 (35%)
C2H2 Zn finger 1292..1313 CDD:275368 3/20 (15%)
C2H2 Zn finger 1322..1342 CDD:275368 7/19 (37%)
zf-H2C2_2 1334..1361 CDD:290200 3/12 (25%)
C2H2 Zn finger 1350..1373 CDD:275368
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 20/86 (23%)
C2H2 Zn finger 228..248 CDD:275368 5/20 (25%)
C2H2 Zn finger 256..313 CDD:275368 11/56 (20%)
C2H2 Zn finger 289..314 CDD:275368 5/24 (21%)
zf-C2H2 323..345 CDD:278523 7/22 (32%)
C2H2 Zn finger 325..345 CDD:275368 7/20 (35%)
C2H2 Zn finger 355..376 CDD:275368 3/20 (15%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.