DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43347 and CG30431

DIOPT Version :9

Sequence 1:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:499 Identity:106/499 - (21%)
Similarity:166/499 - (33%) Gaps:164/499 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   906 EALAREMKME--QNFVEE---------EDEHDIAFRSHQSCRECSIAHDHKLCPLRNACGNVTDA 959
            :|||..:::|  .|..:.         .|..|...|...|.:...:.|:|....:  |.|:....
  Fly    38 KALAPALRLEHGDNLTDVICDLCLRRLHDARDFQRRCEHSEQVLRMRHEHWKHTV--AVGDALAL 100

  Fly   960 VDLGEWIERR--NLEALAKLKADAQRQAKRASGRQRHEDDDMEDMEDMDMDMDESSQLSELETKP 1022
            .|:.|.:||.  :||....:...|.:..       .|....||.::...:|..:||. ||.:   
  Fly   101 DDVLECLEREVGSLEGPMSVPLQASKPV-------AHVAPLMETVDFESLDFQDSSH-SEHD--- 154

  Fly  1023 LITFAEASV-----------PAEFELHNVEPNVTGVFARTEVRAFTKLGPLIGQPVQTGEVREGS 1076
            :.::.|:||           |...||..|||..                     |.::.|     
  Fly   155 IPSYWESSVDSGSLNTPHHQPETAELFAVEPPT---------------------PPESSE----- 193

  Fly  1077 DMKWIFEMCEAGADKSYLLCCDNPNASNWLRFVRPAPSYEERNVNLVSIDRQAY-FVSCRDLRNG 1140
                     |...|     ..:.|.    :|..||      |..|:...:|:|. .|..|.|.  
  Fly   194 ---------EPAPD-----AAEKPK----MRRARP------RQDNVKPKERKASGAVHPRSLH-- 232

  Fly  1141 MELLYWSDDCNTMWRKKHTEKTNCGGCNLKFEHPLYYRTHCSVFHDPSMSLTIRKYHCKVCGEPV 1205
                                  .|..|..||......:.|.:..|..                  
  Fly   233 ----------------------PCPECEKKFTRNFQLKLHMTAVHGM------------------ 257

  Fly  1206 LGKDNIMKHAAEKHDGKGAYQCQFCSKFF-----LRLNYLEMHRTYGCASNPNRSRPV-CDFCGR 1264
                           |:..|||:.|.|.|     ||.:...:|.|         .||. |..|.|
  Fly   258 ---------------GEMRYQCEECRKNFASRHSLRYHVKSVHST---------ERPFGCQHCDR 298

  Fly  1265 KFCQPQKLKAHIKRMHSDMAEVLRDFQCKLCSKLLGSRAALQRHSKEVHSRNSTVVSCPRCQKLF 1329
            :|....:|.:|: |.|:..|:. |.|:|:.|||...:::.|:.|.:..:........|.||.|.|
  Fly   299 RFILRTQLLSHL-RTHTGEAKP-RIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAF 361

  Fly  1330 QNRSNLKIHMLTHSGVRPFKCAEPECNAAFTTKQCLQFHYKKVH 1373
            ..|.:|..|:|.|:|.:||.|  ..|:..:.:...|..|..::|
  Fly   362 FTRGHLNSHLLVHTGEKPFAC--EYCDKCYQSVGNLNNHMVRLH 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 17/75 (23%)
C2H2 Zn finger 1198..1219 CDD:275368 0/20 (0%)
C2H2 Zn finger 1227..1255 CDD:275368 8/32 (25%)
C2H2 Zn finger 1259..1280 CDD:275368 7/20 (35%)
C2H2 Zn finger 1292..1313 CDD:275368 6/20 (30%)
C2H2 Zn finger 1322..1342 CDD:275368 9/19 (47%)
zf-H2C2_2 1334..1361 CDD:290200 9/26 (35%)
C2H2 Zn finger 1350..1373 CDD:275368 4/22 (18%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 9/43 (21%)
C2H2 Zn finger 234..255 CDD:275368 5/20 (25%)
C2H2 Zn finger 264..285 CDD:275368 6/20 (30%)
C2H2 Zn finger 293..313 CDD:275368 7/20 (35%)
zf-C2H2_8 305..373 CDD:292531 21/69 (30%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 9/19 (47%)
zf-H2C2_2 366..389 CDD:290200 9/24 (38%)
C2H2 Zn finger 382..403 CDD:275368 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.