DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43347 and CG4496

DIOPT Version :9

Sequence 1:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster
Sequence 2:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster


Alignment Length:594 Identity:111/594 - (18%)
Similarity:186/594 - (31%) Gaps:207/594 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   926 DIAFRSHQSCRECSIAHDHKLCPLRN-----------ACGNV------------------TDAVD 961
            ::|.....||.:|  ..|..|.|..:           |||.:                  .|.|.
  Fly     2 ELALNKPSSCVDC--CKDCTLLPCCSASACCDASCDAACGLIPPDPVRYEYQEPEENFISIDDVK 64

  Fly   962 LGEWI-----ERRNLEALAKLKADAQRQAKRASGRQRHEDDDMEDMEDMDMDMDESSQLSELETK 1021
            :..::     ::|..|...|...:.:::.||.  ::|.|.:...|.|.:::|.:|:.....|   
  Fly    65 IKSFLWQIGQQQREKELEIKRIMEQEKREKRE--KERREAEKRRDQEVIELDEEEAQSPRGL--- 124

  Fly  1022 PLITFAEASVPAEFELHNVEPNVTGVFARTEVRAFTKLGPLIGQPVQTGEVREGSDMKWIFEMC- 1085
             :|:.|.:.......:..|.|::. :..|...|...::........:..||.|...:......| 
  Fly   125 -IISAARSLAHWNSSIRRVTPDIE-LIPRRVHRVVAEIELSDSDHDEDSEVDEDVSLPSNAVSCV 187

  Fly  1086 --EAGADKSYLLCCDNPNASNWLRFVRPAPSYEERNVNLVSIDRQAYFVSCRDLRNGMELLYWSD 1148
              |...|.|     .||..   |..:.|:...:|:..:.| |.|::         :|...|.   
  Fly   188 LNEQRQDGS-----QNPQE---LVIIVPSDQEDEQKTDNV-IKRKS---------SGSRRLV--- 231

  Fly  1149 DCNTMWRKKHTEKTNCGGCNLKFEHPLYYRTHCSVFHDPSMSLTIRKYHCKVCGEPVLGKDNIMK 1213
                   |:..      |.|.:..|                     .|.|..||:.|....|:.:
  Fly   232 -------KRRP------GANRRGRH---------------------MYECPDCGKKVQSNYNLRR 262

  Fly  1214 HAAEKHDGKGAYQCQFCSKFFLRLNYLEMHRT--------------YGCASNPNRSRPVCDFCGR 1264
            |.. .|.|:..:.|..|.:.|...:.|:.||.              .|.....:.:|  |..|..
  Fly   263 HMM-IHTGERPFPCDLCERRFREFSDLKKHRRRHSHDPQFICMICHLGAPLEQDSTR--CADCES 324

  Fly  1265 KFC----QPQKLKAHIKRMHSD------------------------------------------- 1282
            |..    ||::|.......|||                                           
  Fly   325 KNLMVKPQPEELGEKTTEEHSDEMEGDDDEIEEAALENEKQPQVATQPSLMVTLIPPIQSPPEKV 389

  Fly  1283 ----------------------------------MAEVLRDFQCKLCSKLLGSRAALQRHSKEVH 1313
                                              |:...|.:.|.||.:..|:|..|:||.. :|
  Fly   390 PSHTQPSRPPLPRSCSSANSSSSLSNDGNIAGKSMSRTRRSYPCPLCHRPFGTRHNLKRHYM-IH 453

  Fly  1314 SRNSTVVSCPRCQKLFQNRSNLKIHMLTHSGVRPFKCAEPECNAAFTTKQCLQFHYKKVHNYTQE 1378
            : .....||.:|:|.|:..|.||.||:||...|.:||.  .|.:.|  :..|::...|  |..|:
  Fly   454 T-GEKPFSCSKCRKPFRECSTLKKHMVTHVRDRWYKCL--RCPSKF--RDYLEYSDHK--NNHQD 511

  Fly  1379 QMPKIERSV 1387
            |:...:.|:
  Fly   512 QLSSRKSSI 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 19/87 (22%)
C2H2 Zn finger 1198..1219 CDD:275368 6/20 (30%)
C2H2 Zn finger 1227..1255 CDD:275368 7/41 (17%)
C2H2 Zn finger 1259..1280 CDD:275368 6/24 (25%)
C2H2 Zn finger 1292..1313 CDD:275368 8/20 (40%)
C2H2 Zn finger 1322..1342 CDD:275368 9/19 (47%)
zf-H2C2_2 1334..1361 CDD:290200 11/26 (42%)
C2H2 Zn finger 1350..1373 CDD:275368 5/22 (23%)
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 7/22 (32%)
C2H2 Zn finger 247..267 CDD:275368 6/20 (30%)
zf-H2C2_2 259..282 CDD:290200 6/23 (26%)
C2H2 Zn finger 275..295 CDD:275368 6/19 (32%)
zf-C2H2 431..453 CDD:278523 8/22 (36%)
C2H2 Zn finger 433..453 CDD:275368 8/20 (40%)
zf-H2C2_2 445..468 CDD:290200 8/24 (33%)
C2H2 Zn finger 461..481 CDD:275368 9/19 (47%)
C2H2 Zn finger 489..510 CDD:275368 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.