DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43347 and CG9609

DIOPT Version :9

Sequence 1:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:494 Identity:96/494 - (19%)
Similarity:154/494 - (31%) Gaps:173/494 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1071 EVREGSDMKWIFEMCEAGADKSYLLCCDNPNASNWLRFVRPAPSYEERNVNLVSIDRQAYFVSCR 1135
            ::...|||:...|..:....:.        |:....::....|..|.....|..:||..|.    
  Fly     6 QIASDSDMETALEEFKQRQGRR--------NSIGSAKYACSMPKCEATFKRLDQLDRHEYH---- 58

  Fly  1136 DLRNGMELLYWSDDCNTMWRKKHTEKTNCG--GCNLKFEHPLYYRTHCSVFHDPSMSLTIRKYHC 1198
              ..|:              |||.    |.  ||:..:....:.:.|....|:...|...:...|
  Fly    59 --HTGI--------------KKHA----CSYEGCDKTYSIVTHLKRHLRSTHERPESAAKKTVKC 103

  Fly  1199 KV--CGEPVLGKDNIMKHAAEKHDGKGAYQCQFCSKFFLRLNYLEMH------------------ 1243
            .:  |.:..:...|:.:|..|.|:....|.|..||..|.:...|:.|                  
  Fly   104 ALEECSKMFISVSNMTRHMRETHESPKVYPCSQCSAKFSQKLKLKRHEIREHTLEYPYSCSKCSR 168

  Fly  1244 ---------------RTYGCASNP------------------NRSRPVCDFCGRKFCQPQKLKAH 1275
                           :.|.|...|                  .::|..||.|...|.:|.:||.|
  Fly   169 GFYQQWQCQSHEPSCKLYECPGCPLQFDKWTLYTKHCRDSLHGKNRHKCDRCDSAFDKPSELKRH 233

  Fly  1276 IKRMHSDMAEVLRDFQCKLCSKLLGSRAALQRHSKEVHSRNSTVVSCPR--CQKLFQNRSNLKIH 1338
            ::..|.:.|:.   .:|                        :|..:|..  |.|.:....||:.|
  Fly   234 LEVKHKEAAQT---DEC------------------------ATSFTCNEEGCGKSYSYLRNLRQH 271

  Fly  1339 MLT-HSGVRPFKCAEPECNAAFTTKQCLQFHYKKVHNYTQEQMPKIERSVAYTFDAYSGGMKVDF 1402
            ||| ||| |.|:|...:|...|::.|.|..|..:.|.                    .|..|.:.
  Fly   272 MLTAHSG-RRFECQALDCGRCFSSAQNLARHLLRDHK--------------------DGATKKEL 315

  Fly  1403 LGKQTATATPASAASAQAQPRPNAAVVSPSSFTEQAPRRRRKSLEDQSSMLS--GSLQSDAEFSD 1465
            ..|:...:........::..|                :|||.:...:.|.||  ..||.|.|  |
  Fly   316 KAKKKDKSKTGEGGKTKSTSR----------------KRRRDAGRSKHSRLSKLACLQLDKE--D 362

  Fly  1466 DNLFEAIK--------KSGKSIKDLCRNEPNLSLLSSKI 1496
            |   ||::        |..:|:||    :|...||:..:
  Fly   363 D---EAVRERQPLVLEKITQSLKD----DPVEELLAQTL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 21/122 (17%)
C2H2 Zn finger 1198..1219 CDD:275368 5/22 (23%)
C2H2 Zn finger 1227..1255 CDD:275368 9/78 (12%)
C2H2 Zn finger 1259..1280 CDD:275368 8/20 (40%)
C2H2 Zn finger 1292..1313 CDD:275368 1/20 (5%)
C2H2 Zn finger 1322..1342 CDD:275368 9/22 (41%)
zf-H2C2_2 1334..1361 CDD:290200 14/27 (52%)
C2H2 Zn finger 1350..1373 CDD:275368 6/22 (27%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 6/24 (25%)
zf-C2H2_8 67..150 CDD:292531 18/82 (22%)
C2H2 Zn finger 67..90 CDD:275368 4/22 (18%)
C2H2 Zn finger 106..126 CDD:275368 4/19 (21%)
C2H2 Zn finger 134..155 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..210 CDD:275368 2/21 (10%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
C2H2 Zn finger 253..276 CDD:275368 9/22 (41%)
C2H2 Zn finger 283..302 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.