DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43347 and CG3032

DIOPT Version :9

Sequence 1:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster
Sequence 2:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster


Alignment Length:435 Identity:96/435 - (22%)
Similarity:159/435 - (36%) Gaps:99/435 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1015 LSELETKPLITFAEA-SVPAEFEL---------HNVE---------PNVTGVFARTEVRAFTKLG 1060
            |.:||.:||.|..:: .:|...||         .:||         ||...:..|:.|:.|.|..
  Fly    18 LLQLEKEPLKTELQSDEIPISQELQQLLNINLSQDVENQDADQQWLPNELCLECRSAVQNFEKFR 82

  Fly  1061 PLIGQ-PVQTGEVREGSDMKWIFEMCEAGADKSYLLCCDNPNASNWLRFVRPAPSYE-------- 1116
            ....: ..|..|:.:....:..||:...|.:       ::..:.:.|....|||..:        
  Fly    83 RKADECRKQLLEMLKKDPREPTFEVVYDGRE-------EDQESLHGLEPPEPAPDPDPIDEPAIK 140

  Fly  1117 -----------ERNVNLVSIDRQAY------FVSCRDLRNGMELLYWSDDCN----------TMW 1154
                       .||....|:.|:::      ....|.:..|.:..:..|.|.          |..
  Fly   141 SDKSPRKSFRGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRPFQCDQCEKAYSFMGGLYTHI 205

  Fly  1155 RKKHTEKTN---CG--GCNLKFEHPLYYRTHCSVFHDPSMSLTIRKYHCKVCGEPVLGKDNIMKH 1214
            |:.|..|..   |.  ||...:...:..:.|..:.|.|.....::|:.|:.||.......|:..|
  Fly   206 REVHAPKERRHPCDQPGCERIYTSRIAMQKHKRLKHSPRDRDALKKFICEQCGASFNQSANLKYH 270

  Fly  1215 AAEKHDGK--------GAYQCQFC--------SKFFLRLNYLEMHRTYGCASNPNRSRPVCDFCG 1263
            ...||..:        ||.:..||        |::.|:.:.|:.|...  ...|:.    |..||
  Fly   271 LKTKHPTEDEVAAREGGAGERHFCDICQKEFHSRYTLKYHTLQQHEVQ--EELPHE----CQVCG 329

  Fly  1264 RKFCQPQKLKAHIKRMHSDMAEVLRDFQCKLCSKLLGSRAALQRHSKEVHSRNSTVVSCPRCQKL 1328
            |:..:...|..|: .|||:     ....|:.|.:....|..|:.|.:.||.:... ..|..|.:.
  Fly   330 RRMAKKFMLLQHM-LMHSN-----DKLPCEHCGRRFARRFELEAHVRAVHLKLKP-FPCHHCPES 387

  Fly  1329 FQNRSNLKIHMLTHSGVRPFKCAEPECNAAFTTKQCLQFHYKKVH 1373
            |.:|..|:.|...|:|.:|:.|  ..|..||..:.||:.| :|||
  Fly   388 FASRKTLRHHEYIHTGEKPYIC--DTCGQAFRQQTCLKNH-RKVH 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 20/85 (24%)
C2H2 Zn finger 1198..1219 CDD:275368 5/20 (25%)
C2H2 Zn finger 1227..1255 CDD:275368 7/35 (20%)
C2H2 Zn finger 1259..1280 CDD:275368 6/20 (30%)
C2H2 Zn finger 1292..1313 CDD:275368 5/20 (25%)
C2H2 Zn finger 1322..1342 CDD:275368 6/19 (32%)
zf-H2C2_2 1334..1361 CDD:290200 9/26 (35%)
C2H2 Zn finger 1350..1373 CDD:275368 8/22 (36%)
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 18/76 (24%)
C2H2 Zn finger 158..179 CDD:275368 3/20 (15%)
C2H2 Zn finger 188..209 CDD:275368 4/20 (20%)
C2H2 Zn finger 218..239 CDD:275368 4/20 (20%)
C2H2 Zn finger 254..275 CDD:275368 5/20 (25%)
C2H2 Zn finger 294..315 CDD:275368 4/20 (20%)
C2H2 Zn finger 325..345 CDD:275368 6/20 (30%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.