DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43347 and unc-98

DIOPT Version :9

Sequence 1:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster
Sequence 2:NP_509284.2 Gene:unc-98 / 181020 WormBaseID:WBGene00006827 Length:310 Species:Caenorhabditis elegans


Alignment Length:207 Identity:45/207 - (21%)
Similarity:77/207 - (37%) Gaps:45/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1209 DNIMKHA-AEKHDGKGAYQCQFCSKFFLRLNYLEMH--RTYG----CASNPNRSRP--------- 1257
            |:|.|.| .|:.|.:........:|..::.|.: :|  .|:|    .:.|.|:.:|         
 Worm     3 DDIFKEARKERDDFEELMNACDLAKMSVKNNEM-VHGLETFGINGESSENGNKEKPKEIMKVVAP 66

  Fly  1258 -VCDFCGRKFCQPQKLKAHIKRMHSDMAEVLRD-------------FQCKLCSKLLGSRAALQRH 1308
             |..:.|....|.....:......||..||.:|             ::|:.|.........|:.|
 Worm    67 TVEAYVGSSSAQTPTKSSGGALDGSDQQEVRQDGTSVQKDDNGFVFYKCRFCGLTFNFMNTLRAH 131

  Fly  1309 SKEVHSRNSTVVSCPRCQKLFQNRSNLKIHMLTHSGVRPFKCAEPECNAAFTTKQCLQFHYKKV- 1372
            .: :|..:...| |.:|...|:....|:.|...||.:..:||   ||...|       |.|.:: 
 Worm   132 ER-IHDVSQPYV-CGKCGDSFEFACQLEYHAAQHSEIDGYKC---ECGRTF-------FSYTEML 184

  Fly  1373 -HNYTQEQMPKI 1383
             |.:|.:.:..|
 Worm   185 YHKHTDDPLELI 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 16/75 (21%)
C2H2 Zn finger 1198..1219 CDD:275368 5/10 (50%)
C2H2 Zn finger 1227..1255 CDD:275368 7/33 (21%)
C2H2 Zn finger 1259..1280 CDD:275368 2/20 (10%)
C2H2 Zn finger 1292..1313 CDD:275368 4/20 (20%)
C2H2 Zn finger 1322..1342 CDD:275368 5/19 (26%)
zf-H2C2_2 1334..1361 CDD:290200 9/26 (35%)
C2H2 Zn finger 1350..1373 CDD:275368 6/24 (25%)
unc-98NP_509284.2 C2H2 Zn finger 115..135 CDD:275368 4/20 (20%)
C2H2 Zn finger 143..163 CDD:275368 5/19 (26%)
SFP1 <169..268 CDD:227516 10/38 (26%)
C2H2 Zn finger 171..189 CDD:275368 7/27 (26%)
C2H2 Zn finger 248..268 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.