DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43347 and si:ch211-161m3.4

DIOPT Version :9

Sequence 1:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster
Sequence 2:XP_017210897.1 Gene:si:ch211-161m3.4 / 108183503 ZFINID:ZDB-GENE-110914-169 Length:301 Species:Danio rerio


Alignment Length:237 Identity:62/237 - (26%)
Similarity:106/237 - (44%) Gaps:27/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1155 RKKHTEKTN---CGGCNLKFEHPLYYRTHCSVFHDPSMSLTIRKYHCKVCGEPVLGKDNIMKHAA 1216
            |.:.||..:   |..|...|........|..|..:.      :.|.|:.||:..:.:.::..| .
Zfish    66 RSQETESDSFFICSHCGQTFNSKRSLEVHTKVHTEE------KPYSCQQCGKRFVQERSLKPH-M 123

  Fly  1217 EKHDGKGAYQCQFCSKFFLRLNYLEMHRTYGCASNPNRSRPVCDFCGRKFCQPQKLKAHIKRMHS 1281
            :.|:|:..|.|:.|.|.|.::..|:.|........|..    |..||:.|.|.|.|..|: |:|:
Zfish   124 KVHNGEKPYTCRECGKSFAQIQNLQTHMRIHTGEKPFS----CQQCGKSFTQIQNLNVHM-RVHT 183

  Fly  1282 DMAEVLRDFQCKLCSKLLGSRAALQRHSKEVHSRNSTVVSCPRCQKLFQNRSNLKIHMLTHSGVR 1346
            ..    ..:.|..|.:....:..|..|.: :|: .....:||:|.|.|..:.||.:||.||:|.:
Zfish   184 GN----MPYTCAQCGQCFTHKGNLNAHVR-IHT-GEKPFTCPQCGKSFTQKRNLTVHMRTHTGEK 242

  Fly  1347 PFKCAEPECNAAFTTKQCLQFHYKKVHNYTQEQ-MPKIERSV 1387
            ||.|:  :|..:||.|..|..|   :.|::.|: :..::|.:
Zfish   243 PFTCS--QCGQSFTHKASLVTH---MRNHSDEKPLAGLQRDI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 18/69 (26%)
C2H2 Zn finger 1198..1219 CDD:275368 4/20 (20%)
C2H2 Zn finger 1227..1255 CDD:275368 7/27 (26%)
C2H2 Zn finger 1259..1280 CDD:275368 9/20 (45%)
C2H2 Zn finger 1292..1313 CDD:275368 4/20 (20%)
C2H2 Zn finger 1322..1342 CDD:275368 9/19 (47%)
zf-H2C2_2 1334..1361 CDD:290200 12/26 (46%)
C2H2 Zn finger 1350..1373 CDD:275368 7/22 (32%)
si:ch211-161m3.4XP_017210897.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.