DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and YMC1

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_015383.1 Gene:YMC1 / 856171 SGDID:S000006262 Length:307 Species:Saccharomyces cerevisiae


Alignment Length:297 Identity:84/297 - (28%)
Similarity:124/297 - (41%) Gaps:31/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 DFLAGSLGGAAQVYVSQPLDTVKVKLQTFP------EAYRGMLDCFLSTYRKDGVLRGLYAGSVP 230
            |.|||:.||.|||.|.||.||.||:|||..      |..|.:|       ..:|. ||.|.|::.
Yeast    28 DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLL-------ANEGP-RGFYKGTLT 84

  Fly   231 AVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCKL 295
            .:....|..|:.|......::|... ...:.:..|:..|....|......::....|.|.::.:|
Yeast    85 PLIGVGACVSLQFGVNEAMKRFFHH-RNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRL 148

  Fly   296 QALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEG--TR 358
            |.........|...|.:.         |.:....:...|||:.|.|||..|...:|..||.  ..
Yeast   149 QTQTGSGTNAEFKGPLEC---------IKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIAN 204

  Fly   359 ELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMF-----AVGADIV 418
            ::.:|....:.||...:..|.||:.|..||...:|.|||||.:|..||.:..|     :|...:.
Yeast   205 QMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLY 269

  Fly   419 RREGVLALYRGLLPSVLRTIPATATLFVVYEYTKRAL 455
            ...|:.|.::|..|::||..||....|..:|...|.|
Yeast   270 ANGGIGAFFKGFGPTMLRAAPANGATFATFELAMRLL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 83/295 (28%)
Mito_carr 170..252 CDD:278578 30/85 (35%)
Mito_carr 263..364 CDD:278578 21/102 (21%)
Mito_carr 369..455 CDD:278578 30/90 (33%)
YMC1NP_015383.1 Mito_carr 25..111 CDD:395101 31/91 (34%)
Mito_carr 116..201 CDD:395101 21/93 (23%)
Mito_carr 215..307 CDD:395101 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45624
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.