DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and YMC2

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_009662.3 Gene:YMC2 / 852401 SGDID:S000000308 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:84/327 - (25%)
Similarity:132/327 - (40%) Gaps:76/327 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LIDFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPAVFA 234
            |.|..||::||.|||.|.||.||.||:|||             :|.|.          :...|..
Yeast    35 LKDIFAGTIGGIAQVLVGQPFDTTKVRLQT-------------ATTRT----------TTLEVLR 76

  Fly   235 NVAENSVLFAAYGGCQK---FVAFCVGKE------------------------------TAGDLT 266
            |:.:|..:||.|.|...   .|..||..:                              .:..|.
Yeast    77 NLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLP 141

  Fly   267 TVQNACAGSLAACFSTLTLCPTELIKCKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRG 331
            ..|....|......::....|.|.|:.:||.  :..|    ...::.:.||...:.: :.:|  |
Yeast   142 LSQYYVCGLTGGVVNSFLASPIEQIRIRLQT--QTSN----GGDREFKGPWDCIKKL-KAQG--G 197

  Fly   332 FYRGLSSTFLREMPGYFFFFGSYEGTRELLRRD---DQSKDDIGPLRTMIAGAIGGVCLWTSTFP 393
            ..|||..|.:|...|...:|..||.   |:.|:   ..::::|.|.:..:.||..|..||.:.:|
Yeast   198 LMRGLFPTMIRAGHGLGTYFLVYEA---LVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYP 259

  Fly   394 ADVIKSRIQVKNLNE-----SMFAVGADIVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKR 453
            .||:||.||..:|.:     |:..|...|..:||:.|.::|..|:::|:.|.....|:.:|...|
Yeast   260 LDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324

  Fly   454 AL 455
            .|
Yeast   325 FL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 83/325 (26%)
Mito_carr 170..252 CDD:278578 28/84 (33%)
Mito_carr 263..364 CDD:278578 23/100 (23%)
Mito_carr 369..455 CDD:278578 28/90 (31%)
YMC2NP_009662.3 Mito_carr 34..120 CDD:395101 31/107 (29%)
Mito_carr 138..223 CDD:395101 22/96 (23%)
Mito_carr 235..328 CDD:395101 29/92 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45624
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.