DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and BAC2

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_178108.1 Gene:BAC2 / 844329 AraportID:AT1G79900 Length:296 Species:Arabidopsis thaliana


Alignment Length:315 Identity:90/315 - (28%)
Similarity:137/315 - (43%) Gaps:77/315 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 DFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEA-------------------YRGMLDCFLSTYRK 217
            :|:||..||.|.:....||||::::.|...::                   ||||.....|...:
plant    15 EFVAGGFGGVAGIISGYPLDTLRIRQQQSSKSGSAFSILRRMLAIEGPSSLYRGMAAPLASVTFQ 79

  Fly   218 DGVLRGLYAGSVPAVFANVAENSVLFA---AYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAAC 279
            :.::..:|     |:|:...::||...   :|.|.                     |..|.....
plant    80 NAMVFQIY-----AIFSRSFDSSVPLVEPPSYRGV---------------------ALGGVATGA 118

  Fly   280 FSTLTLCPTELIKCKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREM 344
            ..:|.|.|.||||.:|| |::.|:           .|.||.:.|.|.:|::|.||||:.|.||:.
plant   119 VQSLLLTPVELIKIRLQ-LQQTKS-----------GPITLAKSILRRQGLQGLYRGLTITVLRDA 171

  Fly   345 PGYFFFFGSYEGTRELL----RRDDQSKDDIGPLRTM-IAGAIGGVCLWTSTFPADVIKSRIQVK 404
            |.:..:|.:||..||.|    |:..|..     |||| :||.:.||..|.:.:|.||:|:|:|  
plant   172 PAHGLYFWTYEYVRERLHPGCRKTGQEN-----LRTMLVAGGLAGVASWVACYPLDVVKTRLQ-- 229

  Fly   405 NLNESMFAVGADI----VRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKRAL 455
             .....:...||.    |::||...|:|||..:|.|.......:|..||...|.|
plant   230 -QGHGAYEGIADCFRKSVKQEGYTVLWRGLGTAVARAFVVNGAIFAAYEVALRCL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 89/313 (28%)
Mito_carr 170..252 CDD:278578 23/101 (23%)
Mito_carr 263..364 CDD:278578 35/104 (34%)
Mito_carr 369..455 CDD:278578 30/90 (33%)
BAC2NP_178108.1 Mito_carr <30..94 CDD:365909 13/68 (19%)
Mito_carr 111..189 CDD:365909 32/89 (36%)
Mito_carr 204..285 CDD:365909 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.