DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Slc25a2

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001152747.1 Gene:Slc25a2 / 83885 MGIID:2137907 Length:265 Species:Mus musculus


Alignment Length:266 Identity:123/266 - (46%)
Similarity:170/266 - (63%) Gaps:15/266 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 LQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPAVFANVAENSVLFAAYGGCQKFVAFCVGKET 261
            :||||:.|:|:.||||.||.:.|: ||||.|:.||:.|.|.:.||||..:|.||:||......|.
Mouse     1 MQTFPQLYKGLADCFLKTYNQVGI-RGLYRGTSPALLAYVTQGSVLFMCFGFCQQFVRKVARVEQ 64

  Fly   262 AGDLTTVQNACAGSLAACFSTLTLCPTELIKCKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRT 326
            ..:|..::.|.|||||:.|:.|.||||||:||:||.:.|||...:.|  |...|.|::.:.|:..
Mouse    65 NAELNDLETATAGSLASAFAALALCPTELVKCRLQTMYEMKMSGKIA--QSYNTIWSMVKSIFMK 127

  Fly   327 EGIRGFYRGLSSTFLREMPGYFFFFGSYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTST 391
            :|..|||||||:|..:|:|||||:||.||.:|... ....|||::||:..|::|...|:|||...
Mouse   128 DGPLGFYRGLSTTLAQEIPGYFFYFGGYEISRSFF-ASGGSKDELGPVPLMLSGGFAGICLWLII 191

  Fly   392 FPADVIKSRIQVKNLNESMFAVGA-------DIVRREGVLALYRGLLPSVLRTIPATATLFVVYE 449
            ||.|.|||||||.    |||...|       .:||.||:.|||.||..:::|.||:.|.||:|||
Mouse   192 FPVDCIKSRIQVL----SMFGKPAGLIETFISVVRNEGISALYSGLKATLIRAIPSNAALFLVYE 252

  Fly   450 YTKRAL 455
            |:::.:
Mouse   253 YSRKMM 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 123/264 (47%)
Mito_carr 170..252 CDD:278578 29/54 (54%)
Mito_carr 263..364 CDD:278578 47/100 (47%)
Mito_carr 369..455 CDD:278578 42/92 (46%)
Slc25a2NP_001152747.1 Mito_carr <1..58 CDD:278578 31/57 (54%)
Mito_carr <89..162 CDD:278578 37/74 (50%)
Mito_carr 169..261 CDD:278578 42/94 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6765
eggNOG 1 0.900 - - E1_KOG0763
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 280 1.000 Inparanoid score I2884
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D394188at33208
OrthoFinder 1 1.000 - - FOG0002272
OrthoInspector 1 1.000 - - otm42816
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45624
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1947
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.