DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and SLC25A2

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_114153.1 Gene:SLC25A2 / 83884 HGNCID:22921 Length:301 Species:Homo sapiens


Alignment Length:302 Identity:142/302 - (47%)
Similarity:191/302 - (63%) Gaps:19/302 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 VEGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPA 231
            ::..||..||:.||.|.|...||.||:|||:||||:.|:|:.||||.||.:.| |||.|.|:.||
Human     7 IQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVG-LRGFYKGTGPA 70

  Fly   232 VFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCKLQ 296
            :.|.||||||||..||.||:||....|.:....|:.:|.|.|||.|:.|:.|.||||||:||:||
Human    71 LMAYVAENSVLFMCYGFCQQFVRKVAGMDKQAKLSDLQTAAAGSFASAFAALALCPTELVKCRLQ 135

  Fly   297 AL--REMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGTRE 359
            .:  .||...:..:|    .|.|::.:.|.:.:|..|||.|||||.|:|:||||||||.||.:|.
Human   136 TMYEMEMSGKIAKSH----NTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPGYFFFFGGYELSRS 196

  Fly   360 LLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVGA-------DI 417
            .. ...:|||::||:..|::|.:.|:|||...||.|.|||||||.    ||:...|       .:
Human   197 FF-ASGRSKDELGPVHLMLSGGVAGICLWLVVFPVDCIKSRIQVL----SMYGKQAGFIGTLLSV 256

  Fly   418 VRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKRALSATL 459
            ||.||::|||.||..:::|.|||...|||.|||:::.:...|
Human   257 VRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 141/296 (48%)
Mito_carr 170..252 CDD:278578 48/81 (59%)
Mito_carr 263..364 CDD:278578 47/102 (46%)
Mito_carr 369..455 CDD:278578 41/92 (45%)
SLC25A2NP_114153.1 Solcar 1 7..91 48/84 (57%)
Mito_carr 9..94 CDD:278578 50/85 (59%)
Solcar 2 104..197 47/96 (49%)
Mito_carr <125..198 CDD:278578 37/76 (49%)
Mito_carr 205..296 CDD:278578 41/94 (44%)
Solcar 3 207..293 40/89 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6860
eggNOG 1 0.900 - - E1_KOG0763
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 279 1.000 Inparanoid score I2919
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0002272
OrthoInspector 1 1.000 - - otm40743
orthoMCL 1 0.900 - - OOG6_104887
Panther 1 1.100 - - O PTHR45624
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1947
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.