DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and BOU

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001332469.1 Gene:BOU / 834724 AraportID:AT5G46800 Length:300 Species:Arabidopsis thaliana


Alignment Length:306 Identity:104/306 - (33%)
Similarity:151/306 - (49%) Gaps:35/306 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 DFLAGSLGGAAQVYVSQPLDTVKVKLQTFP-------EAYRGMLDCFLSTYRKDGVLRGLYAGSV 229
            |..:|::|||||:.|..|.||:|||||:.|       ..|.|.:|....|...:|. :|||.| :
plant     7 DLASGTVGGAAQLVVGHPFDTIKVKLQSQPTPAPGQLPRYTGAIDAVKQTVASEGT-KGLYKG-M 69

  Fly   230 PAVFANVAE-NSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKC 293
            .|..|.||. |:|||...|..:..:.    .|....||..|...||:.|....:...||||||||
plant    70 GAPLATVAAFNAVLFTVRGQMEGLLR----SEAGVPLTISQQFVAGAGAGFAVSFLACPTELIKC 130

  Fly   294 KLQALREMKN---------FVEPAHPQDIRTPWTLTRYIWRTE-GIRGFYRGLSSTFLREMPGYF 348
            :|||...:..         .|:...|.|:      .|::.|:| |.||.::||..||.||:||..
plant   131 RLQAQGALAGASTTSSVVAAVKYGGPMDV------ARHVLRSEGGARGLFKGLFPTFAREVPGNA 189

  Fly   349 FFFGSYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAV 413
            ..|.:||..:..|.....: ..:|....::||.:.|...|...:|.||:||.:||.:.....:..
plant   190 TMFAAYEAFKRFLAGGSDT-SSLGQGSLIMAGGVAGASFWGIVYPTDVVKSVLQVDDYKNPRYTG 253

  Fly   414 GAD----IVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKRAL 455
            ..|    |::.|||..||:|..|::.|::||.|..|:.||.|:.:|
plant   254 SMDAFRKILKSEGVKGLYKGFGPAMARSVPANAACFLAYEMTRSSL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 103/304 (34%)
Mito_carr 170..252 CDD:278578 35/87 (40%)
Mito_carr 263..364 CDD:278578 38/110 (35%)
Mito_carr 369..455 CDD:278578 29/89 (33%)
BOUNP_001332469.1 Mito_carr 4..95 CDD:395101 35/89 (39%)
Mito_carr 101..206 CDD:395101 38/110 (35%)
Mito_carr 209..300 CDD:395101 30/91 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45624
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.