DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Slc25a45

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_008758401.1 Gene:Slc25a45 / 689625 RGDID:1589953 Length:292 Species:Rattus norvegicus


Alignment Length:288 Identity:93/288 - (32%)
Similarity:136/288 - (47%) Gaps:21/288 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 GSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAG-SVPAVFANVA-E 238
            ||:.||..:.:..|.|||||:||| ...|:|::||.:.|||.:.|| |.:.| |.|  .|:|| .
  Rat    13 GSVPGAVGLVLGHPFDTVKVRLQT-QNTYQGIVDCVVKTYRHESVL-GFFKGMSFP--IASVALV 73

  Fly   239 NSVLFAAYGGCQKFVAFCVGKETAGDLTTVQN----ACAGSLAACFSTLTLCPTELIKCKLQALR 299
            |||||..|......:.....:|......:..|    .|.|.|...:   .|.|.:|||.:||...
  Rat    74 NSVLFGVYSNTLLALTATSHQERRAQPPSYTNIFIAGCTGGLLQAY---CLAPFDLIKVRLQNQT 135

  Fly   300 EMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGTRELLRRD 364
            |.:..:..:.|: .|.|......|.:.||.:|.:||..:..||:.|....:|.:|||   |.|:.
  Rat   136 EPRMQIGSSTPR-YRGPVHCAASILKEEGPQGLFRGSWALVLRDTPTLGMYFVTYEG---LCRQY 196

  Fly   365 DQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLN----ESMFAVGADIVRREGVLA 425
            .....:......::||...|:..|.:..|.||||||:|:..|.    ..|....|...|:||:..
  Rat   197 TPEGQNPSSATVLVAGGFAGIASWITATPFDVIKSRMQMDGLKGRKYGGMLDCMASSFRQEGIGV 261

  Fly   426 LYRGLLPSVLRTIPATATLFVVYEYTKR 453
            .::|:..:..|..|..|..|:.|||..|
  Rat   262 FFKGMTLNSARAFPVNAATFLSYEYLLR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 93/288 (32%)
Mito_carr 170..252 CDD:278578 35/77 (45%)
Mito_carr 263..364 CDD:278578 30/104 (29%)
Mito_carr 369..455 CDD:278578 27/89 (30%)
Slc25a45XP_008758401.1 Mito_carr 13..81 CDD:278578 34/71 (48%)
Mito_carr 99..190 CDD:278578 25/94 (27%)
Mito_carr 201..292 CDD:278578 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.