DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and CG1907

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:320 Identity:80/320 - (25%)
Similarity:122/320 - (38%) Gaps:60/320 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 IDFLAGSLGGAAQVYVSQPLDTVKVKLQ-----TFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVP 230
            |.||.|.|.|.....|.||||.||.::|     :..:.||..|.|..:...|:|.| .||.|...
  Fly    19 IKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPL-ALYQGIGA 82

  Fly   231 AVFANVAENSVLFAAYGGC-----QKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTEL 290
            |:.......:.....|...     :||.. ..|...:..:.|:..||...:..        |.|:
  Fly    83 ALLRQATYTTGRLGMYTYLNDLFREKFQR-SPGITDSMAMGTIAGACGAFIGT--------PAEV 138

  Fly   291 IKCKLQA-----LREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFF 350
            ...::.:     :.|.:|:...|:        .|.| |.|.||:...:||...|..|.|......
  Fly   139 ALVRMTSDGRLPVAERRNYTNVAN--------ALAR-ITREEGLTALWRGSLPTVGRAMVVNMTQ 194

  Fly   351 FGSYEGTRELLRRDDQSKDDIGPLRT-------MIAGAIGGVCLWTSTFPADVIKSRIQVKNL-- 406
            ..||...:...|.        |||:.       ..|..:.|:....::.|.|:.|:|||...:  
  Fly   195 LASYSQFKTYFRH--------GPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVD 251

  Fly   407 NESMFAVGADIV----RREGVLALYRGLLPSVLRTIPATATLFVVYE-----YTKRALSA 457
            .:..:...||::    |:|||.||::|..|...|..|.|...|::.|     |.|..|.:
  Fly   252 GKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVLGS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 79/316 (25%)
Mito_carr 170..252 CDD:278578 26/90 (29%)
Mito_carr 263..364 CDD:278578 22/105 (21%)
Mito_carr 369..455 CDD:278578 28/103 (27%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 26/90 (29%)
Mito_carr 118..207 CDD:278578 21/105 (20%)
Mito_carr 219..307 CDD:278578 24/87 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.