DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and CG5646

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_651568.1 Gene:CG5646 / 43311 FlyBaseID:FBgn0039525 Length:303 Species:Drosophila melanogaster


Alignment Length:294 Identity:87/294 - (29%)
Similarity:130/294 - (44%) Gaps:18/294 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPAV 232
            |...||:||..|||..|.|:.||||:||..|.   :...::......|.::..:.|.|.|.....
  Fly     4 ENYCDFVAGCFGGACGVLVAHPLDTIKVWQQA---SNSSVVTAIQQIYSRNNGVNGFYRGMFFPF 65

  Fly   233 FANVAENSVLFAAYGG-CQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCKLQ 296
            .:..|.||:||..||. .::....|........|.......|||:|....:...||.||||.:||
  Fly    66 ISTGAINSLLFGIYGNHLRQLRKVCHSDYQREQLEYHNMFLAGSVAGFVQSFIACPMELIKVRLQ 130

  Fly   297 ALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSY-EGT--- 357
            ......:::....    ||.:...:.|.:|:||.|.||||.....|::..|..:..:| :|.   
  Fly   131 TATYYSDYLYGQR----RTAFGTFKRILKTDGISGLYRGLLPMMCRDVLPYGIYMLAYRQGVDYM 191

  Fly   358 --RELLRRDDQSKD--DIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNE--SMFAVGAD 416
              |:.:||.....|  .:..|.|.:|||..||..|....|.||:|:.:|....::  .:|.....
  Fly   192 DRRDFVRRRRSQSDGSSVNLLVTTLAGAWAGVISWVCVIPFDVVKTLMQADENHKYRGIFHCVRV 256

  Fly   417 IVRREGVLALYRGLLPSVLRTIPATATLFVVYEY 450
            ..|..|..:::||....|.|.:|..|..|:.|||
  Fly   257 QYRAYGWRSIFRGSWMLVARAVPFNAATFLGYEY 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 87/294 (30%)
Mito_carr 170..252 CDD:278578 27/82 (33%)
Mito_carr 263..364 CDD:278578 30/106 (28%)
Mito_carr 369..455 CDD:278578 27/86 (31%)
CG5646NP_651568.1 Mito_carr 5..79 CDD:395101 25/76 (33%)
Mito_carr 97..191 CDD:395101 28/97 (29%)
Mito_carr 207..294 CDD:395101 26/84 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45624
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.