DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and CG4743

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:308 Identity:87/308 - (28%)
Similarity:128/308 - (41%) Gaps:48/308 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 NNINFVEGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYA 226
            |.:.|...|:   ||.:.|........|:||||.:||:           .|..:|..| .||:|.
  Fly    23 NKLKFFHALV---AGGVAGMVVDIALFPIDTVKTRLQS-----------ELGFWRAGG-FRGIYK 72

  Fly   227 GSVPAVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNA-----CAGSLAACFSTLTLC 286
            |..||. |..|..:.||        |..:..||:....:|..:::     .|.|.|...:.|...
  Fly    73 GLAPAA-AGSAPTAALF--------FCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRV 128

  Fly   287 PTELIKCKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGI-RGFYRGLSSTFLREMPGYFFF 350
            |.|:.|.:.|.|:..|           ::...:....:||||: ||.|||..||.:||:|.....
  Fly   129 PVEIAKQRSQTLQGNK-----------QSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQ 182

  Fly   351 FGSYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQV---KNLNESMFA 412
            |..:|..:  |:....:..|..|....:.||:.|......|.|.||:|:||.:   ::||....|
  Fly   183 FPLWEYFK--LQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSA 245

  Fly   413 --VGADIVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKRALSAT 458
              :...|....|...|:.|.:|.||......|..|..|:.|.|.|.||
  Fly   246 RRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYDLTTRILGAT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 84/303 (28%)
Mito_carr 170..252 CDD:278578 24/81 (30%)
Mito_carr 263..364 CDD:278578 28/106 (26%)
Mito_carr 369..455 CDD:278578 27/90 (30%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 29/99 (29%)
PTZ00168 25..281 CDD:185494 79/292 (27%)
Mito_carr 199..291 CDD:278578 27/91 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.