DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Dic1

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:280 Identity:65/280 - (23%)
Similarity:115/280 - (41%) Gaps:28/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 GSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPAVFANVAENS 240
            |.|.......|:.|||.:||.||| .:.:..:........|:.||| ..|.|...:|...:..::
  Fly    13 GGLASVGAAMVTHPLDLIKVTLQT-QQGHLSVAQLIPKLAREQGVL-VFYNGLSASVLRQLTYST 75

  Fly   241 VLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCKLQALREMKNFV 305
            ..|..|...:|:    |..::.|....:..| :|.:.....|    |.:::..::|  .::|  :
  Fly    76 ARFGVYEAGKKY----VNTDSFGGKVALAGA-SGLVGGIVGT----PADMVNVRMQ--NDVK--L 127

  Fly   306 EPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGS---YEGTRELLRRDDQS 367
            .|...::....:.....::|.||.:..:.|.::...|   |.....|.   |:.|:..|......
  Fly   128 PPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATAR---GILMTIGQIAFYDQTKIYLLATPYF 189

  Fly   368 KDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVGADIVR---REGVLALYRG 429
            :|::  :....|..:.|....|.|.|.||:|:|..  |.....|....|||:   :.|.|..::|
  Fly   190 QDNL--VTHFTASLVAGTIATTLTQPLDVLKTRSM--NAKPGEFNGLWDIVKHTAKLGPLGFFKG 250

  Fly   430 LLPSVLRTIPATATLFVVYE 449
            .:|:.:|..|.|...||..|
  Fly   251 YVPAFVRLGPHTIITFVFLE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 65/280 (23%)
Mito_carr 170..252 CDD:278578 20/75 (27%)
Mito_carr 263..364 CDD:278578 18/103 (17%)
Mito_carr 369..455 CDD:278578 25/84 (30%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 22/84 (26%)
PTZ00169 13..273 CDD:240302 65/280 (23%)
Mito_carr 89..184 CDD:278578 17/106 (16%)
Mito_carr 189..278 CDD:278578 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.