DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Tpc1

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:329 Identity:91/329 - (27%)
Similarity:135/329 - (41%) Gaps:69/329 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQ----------------TFPEAYRGMLDCFLSTYR 216
            |.|...|||.|..|......||||.:|::.|                .....|..:.....:.||
  Fly    27 EQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYR 91

  Fly   217 KDGVLRGLYAGSVPAVFANVAENSVLFAAYGGCQKFVAF----CVGKETA--GDLTTVQN----A 271
            ::|:| ..:.|..||        .||...||.|| |..:    .:.|:|:  .|...:.|    |
  Fly    92 EEGML-AFWKGHNPA--------QVLSIMYGICQ-FWTYEQLSLMAKQTSYLADHQHLSNFLCGA 146

  Fly   272 CAGSLAACFSTLTLCPTELIKCKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGL 336
            .||..|...||    |.::|:.:|.|....|.:         |........|.|.||.||.||||
  Fly   147 AAGGAAVIIST----PLDVIRTRLIAQDTSKGY---------RNATRAVSAIVRQEGPRGMYRGL 198

  Fly   337 SSTFLREMPGYFFFFGSY----EGTRELLRRDDQSKDDIGPLRTMIA-GAIGGVCLWTSTFPADV 396
            ||..|:..|.....|.:|    :.....|...|:|:   .|..|::. ||..|:...|..:|.|:
  Fly   199 SSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQ---LPTWTLLGLGASSGMLSKTIVYPFDL 260

  Fly   397 IKSRIQVKNLNESMFAVGADI------------VRREGVLALYRGLLPSVLRTIPATATLFVVYE 449
            ||.|:|::....:....|..:            ||:|||..||:|:.|::|::...||..|.:|:
  Fly   261 IKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYD 325

  Fly   450 YTKR 453
            ..|:
  Fly   326 KLKQ 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 91/329 (28%)
Mito_carr 170..252 CDD:278578 26/97 (27%)
Mito_carr 263..364 CDD:278578 31/108 (29%)
Mito_carr 369..455 CDD:278578 28/98 (29%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 27/103 (26%)
PTZ00169 33..329 CDD:240302 88/321 (27%)
Mito_carr 153..222 CDD:278578 24/81 (30%)
Mito_carr 233..328 CDD:278578 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.