DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and CG2616

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:323 Identity:75/323 - (23%)
Similarity:129/323 - (39%) Gaps:71/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 FVEGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVP 230
            :..||:|.|          :.|.|..:....|:..|: :....|..:...|.:| |..|::|..|
  Fly   131 YSNGLMDHL----------FASGPNGSELASLRQRPQ-FSSSWDALMKISRHEG-LAALWSGLGP 183

  Fly   231 AVFANVAENSVLFAAYGGCQKFVAFCVG-----------------KETAGDLTTVQNACAGSLAA 278
            .:.:.:....:.|.||   ::|.|..:.                 ::|...|.:|....:|..|.
  Fly   184 TLVSALPSTIIYFVAY---EQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTAR 245

  Fly   279 CFSTLTLCPTELIKCKLQALR----EMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSST 339
            ..:...:.|.||::.|:||.|    :|..||               |.:...:|:.|.:|||..|
  Fly   246 ICAVTVVSPIELVRTKMQAQRQTYAQMLQFV---------------RSVVALQGVWGLWRGLRPT 295

  Fly   340 FLREMPGYFFFFGSYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVK 404
            .||::|....::..||..::.|....|....:..|..::||.:..:.    |.|.||:|:..|::
  Fly   296 ILRDVPFSGIYWPIYESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIV----TTPFDVVKTHEQIE 356

  Fly   405 NLNE---------------SMFAVGADIVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTK 452
             ..|               |.|:....|.|..||..|:.|..|.:|:..||.|.:...:||:|
  Fly   357 -FGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEYSK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 75/323 (23%)
Mito_carr 170..252 CDD:278578 17/81 (21%)
Mito_carr 263..364 CDD:278578 27/104 (26%)
Mito_carr 369..455 CDD:278578 26/99 (26%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 20/90 (22%)
Mito_carr 230..321 CDD:278578 27/105 (26%)
Mito_carr 321..425 CDD:278578 27/103 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.