DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Dic4

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:304 Identity:74/304 - (24%)
Similarity:121/304 - (39%) Gaps:57/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EGLID-FLAGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPA 231
            |||:. :..|........:...|:|.||..:| .....|.:|......:...|.| |.|.|...|
  Fly    17 EGLLPRWWFGGFASMCVAFAVAPIDIVKTHMQ-IQRQKRSILGTVKRIHSLKGYL-GFYDGFSAA 79

  Fly   232 VFANVAENSVLFAAY--GGCQKFV--AFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIK 292
            :...:...::.|..|  |...::|  ...:||...|       ..||:..:.|.    .||:||.
  Fly    80 ILRQMTSTNIHFIVYDTGKKMEYVDRDSYLGKIILG-------CVAGACGSAFG----IPTDLIN 133

  Fly   293 CKLQALREMKNFVEPAHPQD---------IRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYF 348
            .::|.  :||   ||.:.:.         ||.|        :.||.:..|:|.|....:......
  Fly   134 VRMQT--DMK---EPPYKRRNYKHVFDGLIRIP--------KEEGWKALYKGGSVAVFKSSLSTC 185

  Fly   349 FFFGSYEGTRELLRRDDQSKDDIGPLR-------TMIAGAIGGVCLWTSTFPADVIKSRIQVKNL 406
            .....|:..:..:|::....|.: ||.       ::|:.||        |.|.||:::.:.....
  Fly   186 SQIAFYDIIKTEVRKNISVNDGL-PLHFLTSLGTSIISSAI--------THPLDVVRTIMMNSRP 241

  Fly   407 NESMFAVGADI-VRREGVLALYRGLLPSVLRTIPATATLFVVYE 449
            .|......|.: :.|.||:..|||.:|:::|..|||..|||:||
  Fly   242 GEFRTVFQASVHMMRFGVMGPYRGFVPTIVRKAPATTLLFVLYE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 74/304 (24%)
Mito_carr 170..252 CDD:278578 18/84 (21%)
Mito_carr 263..364 CDD:278578 23/109 (21%)
Mito_carr 369..455 CDD:278578 28/89 (31%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 71/295 (24%)
Mito_carr 26..100 CDD:278578 17/75 (23%)
Mito_carr 104..201 CDD:278578 25/120 (21%)
Mito_carr 211..292 CDD:278578 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.