DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Mpcp2

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:284 Identity:78/284 - (27%)
Similarity:121/284 - (42%) Gaps:28/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 GAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPAVFANVAENSVLFA 244
            |....:| .|||.||.:||.....|:.::..|..|..::|. |||..|..|.:....|:....|.
  Fly    74 GTTHTFV-VPLDLVKCRLQVDQAKYKNLVHGFKVTVAEEGA-RGLAKGWFPTLLGYSAQGLCKFG 136

  Fly   245 AYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCKLQALREMKNFVEPAH 309
            .|...:...|..:|:|.|....|.....|.:.|..|:.:.|.|.|..|.|:|.:....|....|.
  Fly   137 LYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQTIPGYANNFREAV 201

  Fly   310 PQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGTRELL--------RRDDQ 366
            |:           :.:.||:..||:||...::|::|.....|..:|.|.|||        |.|..
  Fly   202 PK-----------MLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRADCT 255

  Fly   367 SKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVGADIVRREGVLALYRGLL 431
            ..:.:  :.|..||.|.||.....:.||||:     |..||::..|....:.:..|...::.||.
  Fly   256 KGEQL--IVTFAAGYIAGVFCAVVSHPADVV-----VSKLNQAKGASAISVAKSLGFSGMWNGLT 313

  Fly   432 PSVLRTIPATATLFVVYEYTKRAL 455
            |.::.....||..:.:|:..|.||
  Fly   314 PRIIMIGTLTALQWFIYDGVKVAL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 76/282 (27%)
Mito_carr 170..252 CDD:278578 21/71 (30%)
Mito_carr 263..364 CDD:278578 28/108 (26%)
Mito_carr 369..455 CDD:278578 22/85 (26%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 21/69 (30%)
Mito_carr <175..245 CDD:278578 23/80 (29%)
Mito_carr 260..338 CDD:278578 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.