DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and slc25a20

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_989099.1 Gene:slc25a20 / 394703 XenbaseID:XB-GENE-971451 Length:301 Species:Xenopus tropicalis


Alignment Length:295 Identity:93/295 - (31%)
Similarity:140/295 - (47%) Gaps:22/295 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 DFLAGSLGGAAQVYVSQPLDTVKVKLQT-------FPEAYRGMLDCFLSTYRKDGVLRGLYAGSV 229
            :|.||..||...|:...||||:||::||       .|..|.|..|||..|...:| |||||.|..
 Frog    13 NFFAGGFGGICLVFAGHPLDTIKVRIQTQPKPVPGIPPLYSGTFDCFKKTLVNEG-LRGLYKGMA 76

  Fly   230 PAVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCK 294
            ..:.......:|.|..:|..:|...    |.....||..|...||.|:..|:|..:.|.|.|||.
 Frog    77 APIIGVTPMFAVCFFGFGLGKKLQQ----KHPEDILTYPQLFAAGMLSGVFTTAIMAPGERIKCL 137

  Fly   295 LQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGTRE 359
            || ::.....|:.|.|.|      ..:.::|..||||.|:|...|.:|::|....:|.:||..:.
 Frog   138 LQ-IQAASGEVKYAGPMD------CAKQLYREAGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKN 195

  Fly   360 LLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNE---SMFAVGADIVRRE 421
            :|..:..|..::...:.:.||.:.|:..|....|.||:|||.|.....:   ....|..:::|.|
 Frog   196 ILTPEGHSVSELSVPKILFAGGMAGIFNWAVAIPPDVLKSRFQTAPAGKYPNGFRDVLRELIREE 260

  Fly   422 GVLALYRGLLPSVLRTIPATATLFVVYEYTKRALS 456
            |:.:||:|....:||..||.|..|:.:|...:.|:
 Frog   261 GIGSLYKGFTAVMLRAFPANAACFLGFEVAMKFLN 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 92/292 (32%)
Mito_carr 170..252 CDD:278578 31/86 (36%)
Mito_carr 263..364 CDD:278578 33/100 (33%)
Mito_carr 369..455 CDD:278578 25/88 (28%)
slc25a20NP_989099.1 Mito_carr 8..102 CDD:365909 32/93 (34%)
Mito_carr 108..198 CDD:365909 32/96 (33%)
Mito_carr 207..294 CDD:365909 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.