DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Bmcp

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:330 Identity:78/330 - (23%)
Similarity:126/330 - (38%) Gaps:86/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 FLAGSLGGAAQVYVSQPLDTVKVKL--------QTFPE-AYRGMLDCFLSTYRKDGVLRGLYAGS 228
            |:.|.:......:.:.|:||.|.:|        |:|.: .||||.|.|:...|::| ||.||:|.
  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEG-LRALYSGI 73

  Fly   229 VPAVFANVAENSVLFAAYGGCQKFV---AFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTEL 290
            .|||.......::.|..|...:|..   ...:.::  |......|....:.|...|:....||::
  Fly    74 WPAVLRQATYGTIKFGTYYTLKKLANERGLLINED--GSERVWSNILCAAAAGAISSAIANPTDV 136

  Fly   291 IKCKLQALREMKN------FVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLR------- 342
            :|.::|...:.::      |.|                |::.||:||.:||:..|..|       
  Fly   137 LKVRMQVHGKGQHKGLLGCFGE----------------IYKYEGVRGLWRGVGPTAQRAVVIASV 185

  Fly   343 EMPGYFF-------FFGSYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSR 400
            |:|.|.|       .||.:.|...:       ...|..|.:.||..           |.|||::|
  Fly   186 ELPVYDFCKLQLMNAFGDHVGNHFI-------SSFIASLGSAIAST-----------PIDVIRTR 232

  Fly   401 IQ-----------------VKNLNESMFAVGADIVRREGVLALYRGLLPSVLRTIPATATLFVVY 448
            :.                 ...|...........:|.||:.|||:|.:|:.:|..|.....|:.|
  Fly   233 LMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITY 297

  Fly   449 EYTKR 453
            |..|:
  Fly   298 EQLKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 78/330 (24%)
Mito_carr 170..252 CDD:278578 27/87 (31%)
Mito_carr 263..364 CDD:278578 26/120 (22%)
Mito_carr 369..455 CDD:278578 24/102 (24%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 27/87 (31%)
Mito_carr <132..199 CDD:278578 19/82 (23%)
Mito_carr 204..303 CDD:278578 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.