DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and CG18418

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:211 Identity:57/211 - (27%)
Similarity:87/211 - (41%) Gaps:43/211 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 VQNACAGSLAACFSTLTLCPTELIKCKLQ-----ALREMKNFVEPAHPQDIRTPWTLTRYIWRTE 327
            |....:|.||.|.    :.|.:|:|.::|     ..||.||..|           .|:: :.:.|
  Fly    19 VMGGTSGMLATCI----VQPLDLLKTRMQISGTLGTREYKNSFE-----------VLSK-VLKNE 67

  Fly   328 GIRGFYRGLSSTFLREMPGYFFFFGSYEGTRELLRRDDQSKDDIGPLRTM--IAGAIGGVCLWTS 390
            ||...|.|||:..||:........|.|:...:..|::..:...:....||  :|||.|.:|    
  Fly    68 GILSLYNGLSAGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMC---- 128

  Fly   391 TFPADVI------------KSRIQVKNLNESMFAVGADIVRREGVLALYRGLLPSVLRTIPATAT 443
            ..||:|.            :.|...||:.::.    ..||:.|||:||:||.||:|.|.:.....
  Fly   129 GNPAEVALIRMMSDNRLMPEDRRNYKNVGDAF----VRIVKDEGVVALWRGCLPTVGRAMVVNMV 189

  Fly   444 LFVVYEYTKRALSATL 459
            ....|...|..|...|
  Fly   190 QLASYSLMKNQLHGYL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 55/205 (27%)
Mito_carr 170..252 CDD:278578
Mito_carr 263..364 CDD:278578 27/100 (27%)
Mito_carr 369..455 CDD:278578 28/99 (28%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 27/104 (26%)
PTZ00169 18..296 CDD:240302 57/211 (27%)
Mito_carr 109..205 CDD:278578 29/103 (28%)
Mito_carr 208..300 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.